(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE486

CP000435.PE486       Location/Qualifiers
FT   CDS_pept        486701..487132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC90888.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45494"
FT                   /db_xref="InterPro:IPR020325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU7"
FT                   /protein_id="ABI45494.1"
FT                   /translation="MFTMQFFVLSHNLQIRSESVPSFTSEELAEGLSLHSEHIKANALK
FT                   HPHWMVLVESDLSVQELAVEVVNSWKKYRNALGHSMNHSLIALGGRKDSATTSSSPLQE
FT                   GYWGVDVVECSDPDVFLESINWDALKSARPEDSVFEYRA"
     ttgttcacca tgcagttttt tgttctctct cacaacttac agattcgttc ggagtctgta        60
     ccttcgttta cttccgagga actcgcagaa ggtcttagcc ttcattctga gcacatcaag       120
     gcaaatgctt tgaaacaccc tcattggatg gttcttgttg agtctgatct ctcagtccaa       180
     gagttggcag tagaagtcgt taattcatgg aaaaaatatc ggaatgctct tggtcactcg       240
     atgaatcatt ctttgattgc tcttggaggt agaaaggatt ctgcaactac gtcaagctca       300
     ccgttgcagg aaggttattg gggtgttgat gtcgtggaat gttcagaccc agatgtattc       360
     cttgagagta tcaattggga tgctctcaag tcagctcgac cggaggattc agttttcgaa       420
     tatagagctt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page