(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE487

CP000435.PE487       Location/Qualifiers
FT   CDS_pept        487619..488947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0499"
FT                   /product="Bilin biosynthesis protein cpeY"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45513"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU6"
FT                   /protein_id="ABI45513.1"
FT                   /translation="MHTSARFDNIHPGLTCEHARQLLMKSVNEQESESDFYTAAAHLIN
FT                   CPCEETQKALIEFLQYRDSSCQSVKITKRKIVEVLARLGCIDAIPAIGKCLWSDDIYLV
FT                   ENTVWSLQTLKCQDRVFVDKIIDILEADVANQRIIIQFLASMGISSSVDIIRSFQSNSI
FT                   PGIKGAAISAIAKLTHDCERVPEISSNLLLPNQMDRHSAIQDLIDANAVDQIAEIFSAP
FT                   VSPVFKLRAVRKLYDENLAESVDSCLLSSLDSLLSCDLSSINCVHRYDEVPSCEYLIRD
FT                   LYNTDFSRCYLALEHLSSHSASEIFPLLKNSWIEEANNDYGAHYCFICLFGSIPVWPGE
FT                   FEPWIIDILVSSIFNIRPQFQKSRAASVLSLAKLHPGILDECMEEILATRGSLPWDMRY
FT                   SLIQAMDHYTDLDMASKSKMILEISDDDKDLFVQARARMALGL"
     ttgcacacgt ccgcaagatt tgacaacatt catccaggtc tgacctgtga gcatgcacgt        60
     caattgctga tgaagtctgt caatgaacaa gaatcagaaa gtgattttta tacagcagca       120
     gcacacttaa tcaattgtcc ttgtgaagaa actcaaaaag ctttaattga atttttgcaa       180
     tatcgtgatt cttcgtgtca atcagtcaaa ataactaaac gcaaaatcgt tgaagtcctg       240
     gcgcgtctgg gatgtattga cgcaattcct gcgatcggca agtgcttatg gtctgacgat       300
     atctatttag tagaaaatac tgtttggtca ttgcaaacat tgaaatgtca agatcgtgta       360
     tttgttgaca aaataatcga tattcttgaa gccgatgtgg ctaatcagag aattatcata       420
     cagttcttgg cttcgatggg tatttccagc agtgttgaca ttattcgttc ttttcagtct       480
     aattctattc cgggaatcaa aggcgctgca atttctgcca ttgcgaagct aacgcatgat       540
     tgtgaaagag ttcctgagat ctcatcgaat ttattattgc ctaatcaaat ggatagacat       600
     tcagctatac aggatctaat tgatgctaat gctgttgatc agatcgctga aatcttttct       660
     gctcctgttt cgcctgtttt taagttacgg gctgttcgta aattatacga tgaaaattta       720
     gctgaaagtg ttgattcttg tttgctttcc tctctagatt ctctcctctc ctgtgacttg       780
     tcttcgatca attgtgttca tcgctatgac gaagtcccct cttgtgagta tctgattaga       840
     gatttgtata atactgactt tagtcggtgt tatttagcgc ttgagcattt atcatctcat       900
     tcagcttctg agattttccc gctgttgaag aattcatgga tcgaggaggc aaataacgat       960
     tatggagccc attattgctt tatttgtctt tttggctcta tacctgtttg gcctggtgaa      1020
     tttgagcctt ggattattga tattcttgtt tcatcgattt tcaatattag gccacaattt      1080
     cagaagagta gagctgcatc tgtattgtca ctggctaagc tgcatcctgg cattcttgat      1140
     gagtgtatgg aggagatttt ggctactcgt ggttcattgc cttgggatat gcgttattcg      1200
     ttaattcaag ctatggatca ctatacagat ctagatatgg catccaaaag caagatgatt      1260
     ttagaaattt ccgatgatga taaggatctc tttgtgcaag ccagagctcg catggcacta      1320
     ggattgtaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page