(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE488

CP000435.PE488       Location/Qualifiers
FT   CDS_pept        488981..489652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0500"
FT                   /product="Bilin biosynthesis protein cpeZ"
FT                   /note="identified by match to protein family HMM PF02985"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46258"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU5"
FT                   /protein_id="ABI46258.1"
FT                   /translation="MLLSPAKIVKSSSCVVSSIISLDDLFLDLSHPNPNIRMDACVLMS
FT                   ENYYDEALPRLLDLLNDPDPVVYRTAVKGLGVFGHRVLPPLLDLFNGTSNCTVKACCIK
FT                   AFVQVAVNFPDNAFPEQAINALKLALEDSNPVVSQSALMTLGYFSKQEHEKGRVIPILI
FT                   QVCNSANIAHVQSAVMSLAEVESTQVDQCFASMINNDSTDVLIKEILESSISRRQSLFG
FT                   D"
     ttgctattgt ctcctgctaa gatcgtaaaa tcttcttctt gtgttgtgtc ttcaataata        60
     tctcttgatg atctgtttct agacttatca catccgaatc ccaatattag aatggatgca       120
     tgtgtattaa tgtcggaaaa ttactatgat gaggctttgc ctcgtcttct tgatcttttg       180
     aatgaccctg atcctgttgt ctaccgtact gcagttaaag gtttaggtgt atttggacat       240
     cgtgttttgc ctcctctgct tgatcttttt aatggcacca gcaattgtac tgtaaaagcc       300
     tgctgtatta aggctttcgt tcaagttgct gtaaattttc cagataatgc tttcccggag       360
     caagcaatca atgcattgaa attagcacta gaagattcaa accctgttgt atctcaatct       420
     gccttgatga ctttgggata tttttcgaag caggagcacg agaaaggtcg tgtcatacct       480
     attttgattc aagtttgcaa tagtgcaaat attgcccatg ttcaatcagc agtgatgtct       540
     cttgctgaag tggaatctac tcaagtagat cagtgtttcg cgagtatgat caataatgat       600
     tcaacagatg tcttgattaa ggaaattctt gagtcaagca tatctcgccg tcaaagcctt       660
     tttggagatt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page