(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE491

CP000435.PE491       Location/Qualifiers
FT   CDS_pept        491491..491625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45195"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU2"
FT                   /protein_id="ABI45195.1"
FT                   /translation="MRGTVFLPALLFVEKAAGPVLVAEVRAFRLVSAPSMMKMGGVVV"
     gtgcggggaa cagtgttttt accagctttg ctttttgttg agaaagcagc gggacctgtt        60
     ctggtcgccg aggtgagggc tttcaggctt gtttctgctc cgagcatgat gaagatgggg       120
     ggagtggtgg tttga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page