(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE494

CP000435.PE494       Location/Qualifiers
FT   CDS_pept        complement(493107..494303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0506"
FT                   /product="CpeY protein"
FT                   /note="identified by similarity to GB:CAA28262.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46546"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT9"
FT                   /protein_id="ABI46546.1"
FT                   /translation="MAERFDVLFEGLSEESSLKILLSDPRDLPNPVDKYMAATRLAACS
FT                   SEESLQGLISAVDLDPEDLFNRITRRKAIEALGRRKNARALDCLFKALHFDDEPSVINA
FT                   ADSITQISAPLTESQCDSLLKALKGNDPQKRAVIQAHTRLGLKSGTSFIQTLIHDENPL
FT                   ISGAARAFCARVEGDLDQLQPLIPQLHDLQAGRRRSAVIDLGDSGDINMLQYLIKSAVS
FT                   MPLRAKSAFQLVDPRKKAGVPEEHNKTITTLLQDDPRSLSMREEWLSQADPIEIEKNLQ
FT                   HRDEGKQYGAALSLLKMPKNQQIEIIDGIHSRLWSDYGANYLLTSLIGLASINERKELI
FT                   KTSLAETLPQYAKSRVAAAWGCLKLDLIDQLDLLKEISTSSQWVPLKWSCSQVLKKFS"
     atggcagagc gattcgatgt cttattcgag ggactgtcag aagagtcatc tctaaaaatc        60
     ctgttatcgg atcccagaga tctgcctaac cctgtagata aatatatggc agcgacacga       120
     ctcgcagcat gctcaagtga agagtcattg cagggactta tcagcgctgt tgatctggat       180
     ccagaggacc tctttaacag aatcacaagg cggaaggcga tagaggcatt gggacggaga       240
     aaaaatgcac gagctttaga ttgcctattt aaggctctac attttgatga tgaaccctcg       300
     gtcatcaacg ccgccgattc aattacacaa atatctgctc ctctcaccga aagtcaatgt       360
     gattcgcttc taaaagccct gaaagggaat gatccacaga aacgagcagt gattcaggca       420
     catacaagac taggccttaa gagtggtaca tcattcattc aaacgctcat ccatgatgag       480
     aacccattga tttcaggagc agcaagggct ttttgcgctc gagtcgaggg cgatcttgat       540
     caactacagc cactgattcc tcaactccat gatcttcaag caggccgacg tcgctctgct       600
     gtcatcgacc ttggcgattc tggtgatatc aacatgttgc aatatctgat caagagtgct       660
     gtgtcgatgc cattacgtgc aaagagtgca tttcaactcg ttgatccaag aaaaaaagca       720
     ggggtacctg aagaacacaa caaaacaatc acaacacttc tacaagatga tccaagaagt       780
     ctttccatgc gcgaagagtg gttgagccaa gcagacccaa tagagattga gaaaaacctg       840
     caacaccgag acgagggtaa acaatacgga gcagcactaa gcctcctaaa aatgcccaag       900
     aatcaacaaa tcgaaataat tgacggtatt cactcacgtt tatggagtga ttacggagca       960
     aactatctgc tgacttcatt gattggcctt gcatccatca atgagagaaa ggagctgatc      1020
     aaaacatccc tggcagagac ccttcctcaa tatgcaaagt caagagttgc cgcagcatgg      1080
     ggctgcctga aactggatct aatcgaccag ctagatctcc tcaaggaaat cagcacaagc      1140
     tcacagtggg tgccactgaa atggagctgc tcgcaagtac ttaagaagtt ttcataa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page