(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE495

CP000435.PE495       Location/Qualifiers
FT   CDS_pept        494479..494799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46360"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT8"
FT                   /protein_id="ABI46360.1"
FT                   /translation="MTVSIEAEKALPRFVQLISQNIDLQDRLNSVTDINSLRSLIQSVE
FT                   PLLTGAALIPLEQATRPPKILVDSGHTSQKIPWRLLRCTGGPLVLQLICMNSNFAIWIE
FT                   SC"
     atgacggtgt ctattgaagc tgaaaaagcg ttgccccgct ttgttcagtt gattagtcaa        60
     aacattgatc tacaggatcg acttaattct gtaactgata ttaattctct taggagcttg       120
     attcagtcag tggagccatt gctgactggt gccgctttga ttccattgga acaagccact       180
     aggcctccta agattttggt tgattctggc catacaagtc aaaaaatccc ttggcgcctt       240
     cttcgttgta ctggaggtcc tttagttctg cagcttatct gtatgaactc aaattttgca       300
     atttggatcg aatcttgtta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page