(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE497

CP000435.PE497       Location/Qualifiers
FT   CDS_pept        complement(495665..496291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAB52704.1; match to
FT                   protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47049"
FT                   /db_xref="GOA:Q0ICT6"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT6"
FT                   /protein_id="ABI47049.1"
FT                   /translation="MESILKFAQTISGIYDNFAQSQENPKDFARINIIFRPLPWKIFNG
FT                   PGFYSEQHYDYAPWSPYRQGIHRLINHRELSNTFIMENFGCANPMRIAGAGRTPELLDS
FT                   LKKENLKKRCGCAMHFETKADRKYIGSVEPGKKCMIPRDGQLTYLVSEVEVTQDSWTSR
FT                   DRGYDPDTNKQIWGSEHGQLIFKKVEDIGEIITNDWINKQFNHER"
     atggaatcta tattaaaatt tgcacaaact atttcgggaa tatatgacaa cttcgcacaa        60
     tctcaagaaa atcccaaaga ctttgctcgc attaatatca tcttcagacc cttaccctgg       120
     aagatcttca atggaccggg attttattca gaacaacact atgactacgc accatggtca       180
     ccatacagac aaggaattca cagattgatc aaccatagag aactatcaaa taccttcatc       240
     atggaaaatt ttgggtgtgc aaatccaatg cgcatagccg gtgctggcag aactcctgaa       300
     cttcttgatt ccttaaaaaa agaaaaccta aaaaagagat gtgggtgtgc aatgcatttc       360
     gaaacaaagg cagacaggaa gtatataggc tcggtagagc caggaaaaaa atgtatgata       420
     ccaagagatg gacaactcac atatttagta agcgaagttg aagtcactca agatagctgg       480
     acaagcagag atcgcggata tgatccagat acaaataaac agatttgggg atctgagcac       540
     ggacaattaa tcttcaagaa ggtagaagat attggcgaaa taattaccaa cgactggata       600
     aacaaacaat tcaaccatga aagatag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page