(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE498

CP000435.PE498       Location/Qualifiers
FT   CDS_pept        complement(496306..496845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0510"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45963"
FT                   /db_xref="GOA:Q0ICT5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT5"
FT                   /protein_id="ABI45963.1"
FT                   /translation="MNIEQFVAQTEGEWRSMRSAHSLAFQQFEDVLSEISVERIDKSDS
FT                   DLQAILKQEGDLSVSDIESPFLMKWAAESDWEPDDPNDVASGQCIIVPIPNNQQSGVLL
FT                   RSVGYAESIAAKSEYNFLDDGTFVLKTRYDQSIAEERIWFVSENVRCRSSVLKTSEGSG
FT                   ILQTSFSSEVRRLVKS"
     atgaatattg agcagtttgt tgctcagact gaaggtgaat ggaggtcaat gcgctcagct        60
     cactctcttg cctttcagca atttgaagat gtcctaagtg aaatttctgt agaaagaatc       120
     gacaaaagtg attctgattt gcaagctata ctaaaacaag aaggtgactt aagtgtatcc       180
     gatattgagt cacctttttt gatgaaatgg gctgctgaaa gtgattggga gcctgatgac       240
     cctaatgatg ttgctagtgg tcagtgtatt atcgtgccaa taccaaacaa tcaacaatca       300
     ggagtactac tcagaagtgt tggttacgca gagtctatag ctgcaaaatc agaatataat       360
     tttctagatg atggcacttt tgtcttaaag acaagatatg atcaatcaat tgctgaagag       420
     agaatttggt ttgtaagcga gaatgtccgt tgtcgatcct ctgtccttaa gacatcagaa       480
     ggttcgggga tactgcaaac gtcattctct tctgaagttc gtagactggt caaatcataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page