(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE503

CP000435.PE503       Location/Qualifiers
FT   CDS_pept        complement(501372..502130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0515"
FT                   /product="possible phycobilisome rod-core linker
FT                   polypeptide (L-RC 28.5)"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47163"
FT                   /db_xref="GOA:Q0ICT0"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT0"
FT                   /protein_id="ABI47163.1"
FT                   /translation="MAIPVRNYSLKSQNSRVNNLAGNNDSIKYQVTGETSASSIAARRD
FT                   VDSLIEQTYKQIFFHAMSCDRDIYLESQLRSGYITMRDFIRGLLLSERFQQGYYQCSSN
FT                   YRMVEQVVGRVLGRSVSGEGERLAWSIVIAEKGFANFVDQILESDEYMSNFGYDGTPAQ
FT                   RGRLIPGRPSGDMPIYQRFPRYGEEWRNSLISREVVNKTFTTGGVKSEMNSIVGKPPAW
FT                   LIKSWLVLFAIGGFEISRVIITIGISMVRN"
     atggctatac ctgttcgcaa ctattctctg aagagccaga acagtcgggt caacaatctt        60
     gctggtaata atgattcaat caagtatcaa gtaacaggag aaacatcagc gtcttcaata       120
     gcagcacgaa gagatgtaga tagcctaatt gaacaaacat ataagcaaat tttctttcat       180
     gcaatgagtt gtgaccgaga catatatctc gaatcacaat taaggagtgg ttacataaca       240
     atgagagact tcataagagg tctcctgttg tcagaaaggt ttcaacaagg atattatcaa       300
     tgcagctcga attacagaat ggtggagcaa gtggtgggga gagtattagg gcgatcagtg       360
     agtggcgagg gtgaaagatt ggcttggtca attgtaattg cagagaaagg attcgcaaat       420
     tttgtagatc aaatactaga aagtgatgaa tatatgagta actttggata tgatggtacg       480
     ccagcacagc gtggcaggtt aataccaggt cggccatctg gagacatgcc aatttatcaa       540
     agatttccac gttatggtga agaatggaga aattcactta tttcaagaga agtcgtcaat       600
     aaaacgttca ctactggtgg tgtgaagagc gagatgaact cgatcgttgg aaaaccaccc       660
     gcatggctga ttaagtcttg gctggtccta tttgcaattg gaggctttga aatatcacga       720
     gtaataatta caatcggaat atcgatggta cgaaattaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page