(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE506

CP000435.PE506       Location/Qualifiers
FT   CDS_pept        complement(503983..504435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS7"
FT                   /protein_id="ABI45316.1"
FT                   /translation="MESTVEQTLSNLLKNSSEEKEVHYNIGNEILRLNLKPEDIMLWRE
FT                   TLKNISNPGNVLLACESNQVDLSTTKLTWIVGAAIRSTKIGKTSEIANLLKSLDIPNDI
FT                   AEAVCKYCPGLGSEVTWAFYLERHGWLTASPIIDIKQLGNWQKDGK"
     atggagagca cagtcgagca gacactctca aacctgctca agaatagctc cgaggagaaa        60
     gaggttcact acaacatcgg gaacgaaatt ttaaggctaa acttaaagcc tgaagacatc       120
     atgctgtgga gagaaacact gaaaaacatt tccaaccctg ggaatgtatt acttgcatgc       180
     gaaagtaatc aagtagattt atcgaccacg aaattaacat ggatcgttgg cgcagcaata       240
     cgctctacaa agatcgggaa aacaagcgaa atagcaaact tgctaaaatc gctcgatatc       300
     ccaaatgata ttgccgaagc agtctgcaaa tattgcccag gacttggatc agaggtaacc       360
     tgggcattct acttagagcg ccatggctgg ctaacagcat ctccaattat tgacatcaaa       420
     caactaggaa attggcaaaa agatggaaaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page