(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE507

CP000435.PE507       Location/Qualifiers
FT   CDS_pept        505038..505466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47354"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS6"
FT                   /protein_id="ABI47354.1"
FT                   /translation="MANSSHDTIPQLSGQLHMISEIAESLTLRLLALEERHNELASRLE
FT                   SVEPDQDENSDSFLLLADSSDRLVQLRGLLSEQVEEDAHVENPRLGVVIDSHDDSENYE
FT                   DEPENFDLEQTEYVNDSQEPPLETLDLDLDQSDELLSA"
     atggccaatt ctagtcatga cacgattccg cagttgagcg gtcaacttca catgattagt        60
     gaaattgctg aatctttgac gctcagattg cttgcgcttg aagaacgaca taacgaactc       120
     gcttcgcgtt tggagtctgt tgagccggat caggatgaga attctgatag ctttttattg       180
     cttgctgata gcagcgatag gctcgtgcaa ctccgtggct tgttgagtga gcaagttgaa       240
     gaggacgcgc atgtcgagaa tcctcgcctc ggggtggtga tcgattccca tgacgactca       300
     gagaactatg aggatgaacc tgagaatttt gatttggagc aaacggagta cgtcaacgat       360
     tcacaggaac cacccttaga aactttggat ctagacctgg atcagagcga cgaacttctt       420
     tcagcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page