(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE515

CP000435.PE515       Location/Qualifiers
FT   CDS_pept        complement(509681..510958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0528"
FT                   /product="Carbohydrate kinase, FGGY family protein"
FT                   /note="identified by match to protein family HMM PF00370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45208"
FT                   /db_xref="GOA:Q0ICR8"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR8"
FT                   /protein_id="ABI45208.1"
FT                   /translation="MSQDPLVLGIDLGTSGVRIAVIDSNFALLQTESSPYQIGLINPFD
FT                   WRERCCTLIGRLKPDYRHRLKAIAVDGTSGTLLACDQQGLPLADALPYSFSCSTFADQL
FT                   EKLSPQGGPASSTSGSLARALHLFDQHKTKAPLLLRHQADWISGWLLDNWSYGEEGNNL
FT                   RLGWNLSKRAWPDSFISQPWWDALPEIRASGSVLGPLSSQRAKDLDLPEDLLVVAGTTD
FT                   SNAAVLTADAEDDEGITVLGSTLVLKRFTDQPLAPWAGTSNHRVGGRWLCGGASNAGAA
FT                   VLKQLFPDIDLAELSRQIDPDQNSGLQLRPLPRCGERFPVDDPQLKPILTPRPVSDSLY
FT                   LHGLLEGLTQIEHAGWQRLTSLGADPPRKIVTLGGGARNPQWRRLRERQLGVPIRSCNT
FT                   PPAAGVARLALQAVKAPDKTHHLREN"
     atgagccaag atccgctggt gctcggcatt gacctaggca ccagcggtgt ccgaattgct        60
     gtcatcgaca gcaactttgc tctgctccag accgaaagtt cgccgtacca gatcggtctg       120
     atcaacccct tcgactggcg agagcgatgt tgcacattga tcgggcgcct caagcccgat       180
     tatcgacatc gccttaaagc catcgccgtg gatggcacct caggaacatt gctggcatgc       240
     gatcaacagg gcctgcccct tgcggatgct ttgccctatt cattctcatg ctcaacattc       300
     gctgatcagc tcgaaaaatt gagtccacag ggtggaccag cttcaagcac cagtgggagc       360
     cttgcacggg cgctgcacct attcgaccaa cacaaaacca aagcccctct cctgcttcgc       420
     catcaagccg actggataag cgggtggctt cttgacaatt ggagctatgg ggaggaaggc       480
     aacaaccttc gactgggatg gaacctgagc aaaagagctt ggccagacag cttcatcagc       540
     caaccctggt gggatgcact tccagagatt cgcgccagtg gctcagtact tggccccctt       600
     tcgtcccaac gcgccaagga tctagacctg ccagaggatc tactggttgt cgctggaaca       660
     acagattcga atgcggccgt tctcacagct gatgctgaag acgacgaggg catcacagtg       720
     ctgggaagca ccttggtgct taaacggttc accgatcagc ccctcgctcc ttgggcaggg       780
     acctccaacc atcgcgtggg gggccgttgg ttatgcggag gagcctccaa tgcgggtgct       840
     gcggtgctga aacaactctt tcctgatatc gacctcgctg aacttagccg tcagatcgat       900
     cctgatcaaa acagcggctt acagctgcgc ccacttccca gatgcggaga gcgatttccc       960
     gttgatgacc cccagctcaa acccatactc acaccccgtc ctgtcagcga ttccctctat      1020
     ctgcatggcc ttttagaggg attaacgcaa attgaacacg cgggatggca acgccttaca      1080
     agccttggag ccgatccgcc aagaaagatc gtgacccttg gaggtggagc gcgcaatcct      1140
     caatggcgtc gcctgcgcga gcgccaactc ggtgttccga tccgcagttg caacacacct      1200
     ccagccgccg gagtcgcgcg tctggctctg caggctgtga aagcaccaga caagactcat      1260
     catctaaggg agaattag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page