(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE525

CP000435.PE525       Location/Qualifiers
FT   CDS_pept        518376..518825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0538"
FT                   /product="Predicted thioesterase"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47053"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ8"
FT                   /protein_id="ABI47053.1"
FT                   /translation="MVTESVTRLPWQLHKRVLPQHTDHGGVMWHGAYVGWLEEARVEAL
FT                   AAVGLPYRVMALEGLEMPVVRLEMSYKRALLHGDQVVLESHALPPEGPRWRWRTRLLVA
FT                   DGDCAFEADVELVLVRLDGGRRQVLRRPPPSVATALQRLTQGPDR"
     atggtgactg agagcgttac gcgccttcct tggcaattac acaagcgtgt gctgccacag        60
     cacacagatc acggcggtgt gatgtggcac ggcgcctatg tcggttggtt ggaagaagcc       120
     cgtgtggaag cactcgcggc tgtggggctt ccctaccgag tgatggcgct tgaagggttg       180
     gaaatgccag tggtgcgctt ggagatgtct tacaagcgag ccctgttgca tggtgaccag       240
     gttgtgcttg aaagccatgc gcttcctcct gagggccccc gctggcgctg gcggacgcgt       300
     ctgttggtgg ccgatggtga ttgtgctttc gaggcggatg tggagttggt gttggtccgt       360
     ctcgacggtg gacgacgtca ggttttgcgc cgaccgccgc catccgttgc cacagcgcta       420
     cagcgattga cccaggggcc agatcgatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page