(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE526

CP000435.PE526       Location/Qualifiers
FT   CDS_pept        518855..519961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0539"
FT                   /product="putative DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45303"
FT                   /db_xref="GOA:Q0ICQ7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ7"
FT                   /protein_id="ABI45303.1"
FT                   /translation="MLGERGWWWLWISCPGLGVARIRALRAVANAHQVTLADLWSWPLV
FT                   RLQGALRWPDSLMARVESYRLSKGALPSLLVPDNALFPLDLDWPIAFDSLQRPPLAVHW
FT                   SGQKACWPFLSAQKAVAVVGTRRPSDHGCRMAHALGQCLARAGWPVVSGLAEGIDAASH
FT                   HGCLAASGLPVGVLGTPLDRVYPPEHEALQAQVESAGLLLSEWPRGARVQRSNFALRNR
FT                   LLVSVSCALVVVECPETSGSLLSAQIAHTQDCPVWVVPGDALRWSCKGSNGLLQEGATP
FT                   LLSPESLIAALGPGPLAAARTASMTLDRSRFSVDRNHSLLRGVDQGLTLEQLSAALSCS
FT                   PTQLAHELLQLELAGVIEPKPGLRWRSV"
     ttgttgggag agcgtggctg gtggtggtta tggatctcat gccccggact cggtgttgcc        60
     aggattaggg cgctgagggc tgttgctaat gcccatcagg tgaccttggc cgatttgtgg       120
     tcatggcctc ttgttcgttt gcaaggagcg cttcgctggc ctgactcctt gatggcgcgt       180
     gtcgagtctt atcggctgag caaaggagct ctccccagcc ttttggttcc agacaatgct       240
     cttttccccc tggatttgga ctggccgatc gcatttgatt ccttgcagcg ccctcctctt       300
     gctgtgcact ggtcggggca gaaggcgtgc tggcctttct tatccgctca aaaggctgta       360
     gcggtggtgg gaacgcgccg accatcggat catggctgtc ggatggcgca tgctcttggt       420
     cagtgcctcg cccgtgctgg ttggcccgtg gtgagtggtc ttgccgaggg aattgatgcc       480
     gcctctcacc atggttgtct tgcagcgagt ggacttccag taggtgtgtt gggtacgccg       540
     ttggatcgtg tgtatccgcc tgagcatgag gccctgcagg cccaagtgga gtctgctggc       600
     ctgttgttga gcgaatggcc tcgcggtgcg cgggtgcaga gatccaattt tgctttgcgg       660
     aatcgtcttc tggtgagtgt gtcttgtgcc ctagtggtgg ttgagtgccc agagacaagc       720
     ggctcactgc tatcagccca gattgctcat actcaagatt gtcctgtttg ggtggttcca       780
     ggggatgcgc tgcgttggtc ttgtaagggc agcaacggtt tgttgcagga gggggcaaca       840
     cccttgctat cgcctgaatc attgattgcg gccctaggtc cagggccgct tgcggccgcg       900
     aggactgcgt cgatgacatt ggaccgatcc cggttttcag tcgatcggaa tcattcgctt       960
     ctgcgtggcg ttgatcaagg gctcaccctt gagcagctat ctgcagcact cagctgcagt      1020
     cccactcaat tggcgcatga gttgttgcaa ctcgagctcg cgggtgttat tgagcccaag      1080
     cctggactgc gttggcggtc cgtttaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page