(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE528

CP000435.PE528       Location/Qualifiers
FT   CDS_pept        520888..521505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0541"
FT                   /product="yrdC domain, putative"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46566"
FT                   /db_xref="GOA:Q0ICQ5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ5"
FT                   /protein_id="ABI46566.1"
FT                   /translation="MTINPLNLFDRDRTEAHLRAGGAALLPTDTLPALASMPEQAAQIW
FT                   RLKKRPQDKPLILMGADVDALLCHVSPVARADASALAQRHWPGALTLVLPAFGPCAETL
FT                   NPGCATLGLRIPACKPMLDLLRCSGPLATTSANLSGEPASRTETEAAGAFPDLPLLAPI
FT                   PWPAPSCQASSVIAWRGPQDWHCLRRGAVMPVGVVSLPECSG"
     atgacgatca atcccctcaa tctgttcgat cgcgatcgaa ccgaagcgca tttgcgtgct        60
     ggcggcgcag ccttactccc aacagacacc ctcccggcat tggcttcgat gccagagcag       120
     gcggctcaaa tttggagatt gaaaaaacgg ccacaggaca agccgttgat cctgatgggt       180
     gctgacgttg atgcgttgtt gtgtcatgtc tcccccgttg ctcgagccga tgccagtgca       240
     cttgcgcaac ggcactggcc aggagctctc accctggtct tgccagcctt tggtccctgc       300
     gcagagacgc tcaacccggg atgcgcaacc cttggtttgc gcatcccggc ttgtaagccc       360
     atgttggatc ttctgcgttg cagcggtccg cttgccacga ccagtgccaa cctttcggga       420
     gagcccgcca gtcgaaccga aacggaggct gctggcgcat ttccagactt gccgttgctt       480
     gcaccgatcc cttggccagc cccttcttgt caagcgagct cggtgattgc ttggcgagga       540
     cctcaagact ggcattgcct gcgcagaggc gctgtgatgc cagtaggtgt agtgagcctt       600
     cccgaatgct ctggttaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page