(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE529

CP000435.PE529       Location/Qualifiers
FT   CDS_pept        complement(521766..522035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0543"
FT                   /product="possible transcriptional regulator, luxR family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45557"
FT                   /db_xref="GOA:Q0ICQ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ4"
FT                   /protein_id="ABI45557.1"
FT                   /translation="MVLEASPDLMAEQGFTPAETAVVQLLLEGLSNRAIASRLVVSIRT
FT                   VESHISNALDKSGCRSRLELSMWWLRNHSESTRTRSVKLPTMPA"
     atggttctag aagcatctcc agaccttatg gctgagcaag gcttcacccc agcagaaacc        60
     gccgtggtcc aactccttct tgaggggctt agcaatcggg ccatcgcttc cagactggtg       120
     gtgagcatcc gcactgtgga aagtcacatc agcaacgctc tcgataaaag tgggtgccgt       180
     tcgagacttg agctttcaat gtggtggctc agaaaccatt cagagtccac aagaacgcgc       240
     agcgttaaac tcccaacaat gccggcttag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page