(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE538

CP000435.PE538       Location/Qualifiers
FT   CDS_pept        529313..529477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46699"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP5"
FT                   /protein_id="ABI46699.1"
FT                   /translation="MMDFALASGSKSGDALIPPRLQRGCVLGYGFGLRGGVTLRGAAEG
FT                   CKERKLEVF"
     gtgatggact ttgctctggc cagtggaagc aagtctggag atgctctcat ccctccaagg        60
     ttgcaaagag ggtgtgtgtt gggttatggt tttggactgc gcgggggagt aacactccga       120
     ggcgcagccg agggatgcaa agagcgaaag cttgaagtgt tctga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page