(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE540

CP000435.PE540       Location/Qualifiers
FT   CDS_pept        complement(535589..536875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0559"
FT                   /product="Sulfate permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45731"
FT                   /db_xref="GOA:Q0ICP3"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP3"
FT                   /protein_id="ABI45731.1"
FT                   /translation="MPSLRQKINSLAIAPLPNLLAGLVMALVLIPEAIGFAGVAGVPPE
FT                   LGLYGAIFLTITIAFTGSRIAMITSASGSTAVLMTGLAAQGNNFADNKGIIFLLTASML
FT                   AGLLQIIWSLLNISALMKYIPKPVVSGFVNALALLILQAELPQLGFEQLLGLERHQVTY
FT                   LPTVKELPTVWALTAIGLLIIYSFPYITKKIPSQLISISVVTILAWTMRFDVPRVSDLG
FT                   SLPQGIHLPEIPFLINGANNIAGLDLIWTTAPIAIAISLVGLLETFLTVDYIDTLTETT
FT                   ADKRSEGIGQGIANIITSLFGGMAGCALVGESVMNVKNGAKSRLSTLSTGLFIVTILIF
FT                   ARSILGLIPLAAVAAVMISIAVATADSDSLRRIGRLPKIDTLLMIATFLATMLTHPHNL
FT                   AVGVIVGVSTSQLYGYIRRKANLRSDKSD"
     atgccttctc ttagacaaaa aataaactct ttagcaatag caccgttacc aaatctgctg        60
     gctggcctgg tgatggcatt ggtacttatt ccggaagcaa tcggcttcgc tggagtcgct       120
     ggagtccctc cagaacttgg cctctatggc gcaatctttc taacgatcac aatcgccttc       180
     acaggaagtc gaatcgcgat gatcacctcg gcatcaggat caaccgcagt actcatgacc       240
     gggcttgcag ctcaaggaaa taactttgca gacaacaaag gaattatttt tttattaaca       300
     gcaagcatgc ttgcggggct tctccagatc atctggagcc tcttgaatat ttcggcttta       360
     atgaaataca tcccaaaacc tgtcgtgagt ggattcgtca atgcactggc attactcatt       420
     ttacaagcag aattgccaca acttggcttt gaacaacttc taggacttga aagacatcag       480
     gtaacttacc tgccaacagt gaaagagcta ccaaccgtat gggctttgac agcgatagga       540
     ctactaatca tctattcatt tccatacatc acgaagaaaa taccctcaca gctcatctca       600
     atttctgtcg taacaatact ggcatggacg atgagattcg acgtaccaag agttagtgat       660
     ctgggaagcc taccgcaggg aatccactta ccggaaatcc cattcctcat caatggagcg       720
     aacaacattg caggccttga tcttatatgg acaacagcac cgatcgcaat tgcaatttcg       780
     ctcgtaggcc tattagaaac atttctaaca gtcgattaca tcgatacact aacagaaaca       840
     acagcggata agcggtcgga aggcattgga caaggcatcg ccaatatcat tacatcacta       900
     tttggcggaa tggccggatg tgcactcgta ggcgaatcgg tcatgaacgt gaaaaatggg       960
     gcaaaatcac gactatcaac cttatcgacg ggactattta tagttactat tctaattttt      1020
     gcaagatcaa ttcttggctt aattcccttg gccgcagtcg ccgcagttat gatttcaatc      1080
     gcagttgcaa ccgcagattc tgacagcttg aggagaatag ggagactacc taagatcgac      1140
     actcttctca tgatcgctac atttttagcg acgatgctga ctcatcccca caaccttgct      1200
     gtaggcgtga tcgtaggcgt gagcacatct cagttatacg gatacatccg aagaaaagcc      1260
     aatctacgat cagataaaag cgattag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page