(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE551

CP000435.PE551       Location/Qualifiers
FT   CDS_pept        548304..549761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0570"
FT                   /product="Glycoside hydrolase family protein"
FT                   /EC_number="3.2.1.135"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45950"
FT                   /db_xref="GOA:Q0ICN2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN2"
FT                   /protein_id="ABI45950.1"
FT                   /translation="MGSEACKGMAETPRIGRFPAWVAEAVVYQVFPDRFRRSGRVEAQQ
FT                   GLSMQPWGTEPVEHGFQGGDLYGVIDALDHLQGLGVTCLYLTPVFSSAANHRYHTYNYL
FT                   EVDPLLGGNQALDALIAAVHQRGMRLILDGVFNHCGRGFWAFHHLLENGDSSPYRQWFH
FT                   VHQWPLRPYPGRGQACGYSCWWNDPALPKFNHDHAPVKDHLLAVGKYWLERGIDGWRLD
FT                   VPDEVPSEFWMDFRRMVKAVNPEAWIVGEIWGDARPWLQGEHFDGVMNYRLGWSSLCWV
FT                   AGSRLRRRYHNPMYPLRPLQTEALLEIWSETQGWYAPEVNRCQLNLLDSHDVPRALHSL
FT                   KGDVAALSLALLMLMLQPGAPCLYYGTEAGLEGGAEPDCREAMPWEEPWPHDLCTMIKA
FT                   LTKIRQQVEALRECGLFWQACASDGLIGRAPGVVVVVNRSRRKALLLESHDVPQVGWKT
FT                   NDALIGTYQVARHALGPQSAVLFKALR"
     atgggatcag aggcctgcaa aggaatggcg gagacaccac gcattggccg gttccccgct        60
     tgggttgctg aggcggtggt gtatcaagta ttccctgatc gttttcgccg gagcggcagg       120
     gtggaagccc agcagggttt gtcgatgcag ccctggggta cagagccggt agagcatggg       180
     tttcaggggg gagatctgta tggcgtgatc gatgctctcg accaccttca agggttggga       240
     gtgacctgct tgtatctcac gccggtattt agttcggcgg ccaaccatcg ctatcacacc       300
     tacaactatc tcgaggtgga cccactcctg ggaggcaatc aagcccttga tgccctgatt       360
     gccgcagtgc atcaacgagg catgcgcctg atcctcgatg gggtgttcaa ccattgcggg       420
     cgaggctttt gggcgtttca tcatttgctg gaaaacggtg atagctctcc ctatcgccag       480
     tggttccatg tgcatcagtg gccgctgcgg ccctatccgg gcaggggcca ggcctgtggc       540
     tacagctgct ggtggaatga tccagcgcta ccgaagttca accacgacca tgcccccgtc       600
     aaggaccacc tattagctgt tgggaagtac tggctggaac ggggcatcga cggttggcgt       660
     ttggacgtgc ccgatgaggt gccatcggag ttttggatgg actttcggcg catggtgaag       720
     gcggtgaacc cagaggcctg gatcgtgggt gagatttggg gcgatgcccg gccgtggctc       780
     caaggggagc atttcgatgg ggtgatgaat taccgcttgg gctggagcag cctctgctgg       840
     gtggctggct ctcgcctgcg tcgtcgctat cacaatccga tgtacccgtt gcgccccctc       900
     cagacggagg cattgcttga gatctggtct gagacgcagg gatggtatgc gccggaggtg       960
     aatcgctgcc agctcaatct tttggatagt cacgatgtgc cccgggcctt gcacagcctg      1020
     aaaggagatg tggctgcgct gtctttggcg ttgctgatgt tgatgcttca gcccggggcc      1080
     ccttgcctct actacggaac ggaagcgggt ctggagggtg gtgccgaacc ggactgtcgc      1140
     gaggcgatgc cgtgggagga gccttggccc catgatttgt gcacgatgat caaagcgttg      1200
     accaagattc gccaacaggt tgaggccttg agagaatgtg ggttgttctg gcaggcttgc      1260
     gccagtgatg gcctcatagg ccgcgcgcct ggggtggtag tggttgtaaa ccgctctcga      1320
     aggaaagctt tgctactgga gtctcacgac gttccgcaag ttggctggaa gacgaatgac      1380
     gcgttgattg gcacttacca ggtggctcgc catgcacttg gtcctcaatc agcggtgtta      1440
     tttaaggctc taagatga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page