(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE552

CP000435.PE552       Location/Qualifiers
FT   CDS_pept        complement(549790..550320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN1"
FT                   /protein_id="ABI47390.1"
FT                   /translation="MVSLDLLSSFDGMIWLQSGKKVGALFGQHQTTISRNQKKCAQAFD
FT                   IKLQKISSNWQPQGDSSPLLHLERMVHQVARFQGKSSLRLDANRWLDSDLFNPPPAGWL
FT                   VSSAKNVTNPHSLECLQKRIVDACLCPLTDLPTENQSLKNIELKSKKIGVIVLQEHADQ
FT                   ERILGLINMLQQA"
     atggtcagct tggatttact ttctagtttt gatggaatga tatggcttca gtccggaaag        60
     aaagtaggtg cactctttgg tcaacaccaa acaacaataa gtcgaaatca aaaaaaatgt       120
     gctcaggcct tcgacattaa acttcaaaaa ataagcagca attggcaacc ccaaggggat       180
     tcttctccct tgcttcactt ggagcgcatg gttcatcaag tggcgcgttt tcaagggaaa       240
     tcaagcttga gacttgacgc caatcgctgg cttgacagtg accttttcaa tccaccaccc       300
     gctggctggc ttgtatcttc agccaaaaac gtcaccaatc cccacagtct ggaatgcttg       360
     caaaaacgca ttgtggacgc ttgcctatgt cctcttactg atcttccaac agaaaatcaa       420
     tccctaaaaa atattgaact caagtccaag aagattggcg ttatcgtact tcaagaacat       480
     gctgatcaag aacgaatctt aggtctcatc aacatgcttc agcaggctta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page