(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE554

CP000435.PE554       Location/Qualifiers
FT   CDS_pept        complement(551143..553218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0573"
FT                   /product="two-component hybrid sensor and regulator
FT                   alr4878, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45424"
FT                   /db_xref="GOA:Q0ICM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM9"
FT                   /protein_id="ABI45424.1"
FT                   /translation="MKTQFKSLAEKLTRTTGLQLILVAGSLSILGFSVGRNNVIEQKES
FT                   HRAHLPVIRVSERLSSKISFPTIINQLNEEAISADPELLKDFDKLSLRFWRQLRSFPVD
FT                   YINYGSEDGSFLGIEKSEDGSLFHNEDSARLGRGKMFVYSMTTTGERLKQEDVIPEMSP
FT                   THQEAWYVDTVKAGKPTWSKIYSWEDQPETFSISYNAPIFNQEEKLIGVVGVDMIIDKL
FT                   SNWLQDAWKDQSGLALIVEKNGNVVASSKPKIVLVRSGKTIQRANIQELDSPLAKSLSR
FT                   RYFSQQGENLLVNEKNFKQELVQISSLGSQHFVLRATPWGQEFGLDWFLVTGTSADQEV
FT                   SMAERNLMLMIFISIAALLLALAINRRLINALLTPLGALTSASQSTEQQITDTTKQPEV
FT                   LSFKCEIQKSGAKEFSDLHQAITAMVKAFNNLTQSLKSKEKQIIELFKEKQDKDEQELS
FT                   VMSKKLKTSLEAGSIAHEINQPLSILKLTSQTLINALDNNSKSPNISELKQQLSTINSQ
FT                   SERIILITDKVRALLRNAQTELSDLDLKQVVQSSLRYIHSNNPGSHGWINSKQIDSIAD
FT                   SSAVITGDAVQLQIALINIFKNSIESLREPQHHAPLILVSLKENENFWIIEIEDNGGGL
FT                   LPEMSEESLMKSNKPDGTGLGLFIVRMTMESHNGHLSLLNGSQGGLLAQLSLPKNS"
     atgaaaacac aatttaagtc attagcagaa aagctaactc gcacgacagg gcttcagctg        60
     attctcgttg caggatctct cagcatttta gggtttagtg ttggacgcaa caatgtaatt       120
     gagcagaaag aatcccatcg cgcgcatcta ccagtcatac gagtatcaga acgattaagc       180
     agcaagatca gttttccaac gattattaat cagctcaacg aagaggcgat ctctgccgac       240
     ccagagttac tgaaggattt cgataagctc agcctacgtt tctggaggca gcttcgctca       300
     ttcccagttg attacatcaa ctatggatca gaagacgggt catttcttgg catcgaaaaa       360
     agcgaggatg gcagtctttt ccacaacgaa gacagcgcac ggttaggtcg ggggaaaatg       420
     tttgtttaca gcatgacgac aacgggggaa cgtcttaagc aggaagatgt aatcccagag       480
     atgagcccaa cacaccaaga agcttggtac gtcgataccg tgaaagctgg aaaaccaaca       540
     tggagcaaga tttattcctg ggaagaccag ccagaaacct tttcaatttc gtacaacgca       600
     ccaatcttta atcaggaaga aaagcttatt ggagttgttg gcgttgacat gatcatcgac       660
     aaactaagca actggcttca agacgcatgg aaagatcagt caggcctggc attaattgta       720
     gagaaaaatg gaaatgtagt tgccagttca aagcctaaaa tagtgcttgt tcgctcaggc       780
     aaaacaatcc agagagccaa tattcaagaa ctagactctc cattagcaaa atccctttca       840
     aggagatact tttcgcaaca aggagagaat cttcttgtta atgaaaaaaa ctttaaacaa       900
     gaacttgttc aaatctcaag tttaggctca cagcactttg ttttgagagc tacaccttgg       960
     ggacaagagt tcggcctcga ttggttttta gtaacgggta catcagctga tcaagaagtg      1020
     agcatggcag agcggaattt gatgctgatg attttcatca gcattgcagc cctccttcta      1080
     gccttagcta ttaaccgccg cttgattaat gccctactca cacccctagg agcattaaca      1140
     tcagcaagcc aaagcacaga acaacaaatt acagatacaa caaaacaacc tgaagtgctc      1200
     agcttcaaat gtgagattca aaaatctgga gccaaggaat ttagcgatct ccatcaagcc      1260
     attacagcca tggtgaaagc attcaataat ctcacccaaa gcctaaagag taaagaaaaa      1320
     caaatcatcg aactgttcaa agaaaaacaa gataaagatg aacaagagct ttccgtgatg      1380
     agcaaaaaat taaaaacaag ccttgaagct ggatccatcg ctcacgaaat caaccaaccc      1440
     ctaagcatcc taaagctgac atctcagacc ttgatcaatg ctcttgacaa caacagcaaa      1500
     agcccaaata tatctgagct taaacaacag ctttcaacta tcaattctca atcagagagg      1560
     attattttga ttacagataa agtacgagca cttctccgca atgcccaaac agaactctct      1620
     gatctcgatt taaagcaagt agttcaaagc agcttgcgct atatccactc aaataatcca      1680
     ggcagtcatg gctggatcaa cagtaaacaa atcgactcga ttgcagattc aagcgcagtc      1740
     attacagggg atgcagtgca attacaaatt gctctcatca atatttttaa aaactctatc      1800
     gaatctttac gcgagcctca acatcatgct ccattaatac ttgtaagctt gaaagaaaat      1860
     gaaaacttct ggatcataga gattgaagat aatggaggag gtcttttgcc agagatgagt      1920
     gaagagtctc tgatgaaaag caataaaccc gatggcacag gacttggcct gttcattgtg      1980
     cgcatgacga tggagagcca taacggtcat ttatctcttc tcaacggttc acagggagga      2040
     ctgcttgccc aactcagtct tcccaaaaat agctaa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page