(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE56

CP000435.PE56        Location/Qualifiers
FT   CDS_pept        complement(58881..59456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0057"
FT                   /product="putative photosystem I assembly related protein
FT                   Ycf37"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45320"
FT                   /db_xref="GOA:Q0IE27"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE27"
FT                   /protein_id="ABI45320.1"
FT                   /translation="MNSLLPQTYLLGLIGLLAIVAVVGGRQFLRVRRDEQSLLKMEQDK
FT                   VASSKDAGALYELASVQLRKRLYPQAIVTLRQAVKRLNDEPDEARALIENALGYALAAE
FT                   KDFTTAVRHYKSALRAKENYPVAINNLAFAQERLLENEEACALYRKALVLDPKNKTARK
FT                   RLNRLERAASKSKNSSQASPKSPDGRGF"
     atgaattcct tgctgcctca gacctatttg ttgggcctga tcggcctctt ggcgatcgtt        60
     gctgttgtcg gcggtcgcca atttttacgt gttcgtcgcg acgaacaaag tttgctcaag       120
     atggagcaag acaaggtcgc ctcctccaaa gacgcaggtg ctttgtatga gctggcgtcg       180
     gttcaattgc gcaagcgttt gtacccccag gccattgtga ccttgcgcca ggcggttaaa       240
     aggctcaacg acgagcccga tgaagcgcgg gcgctcattg agaatgccct gggctacgcg       300
     ctagcagcgg aaaaagattt tacgactgcc gtacgccatt acaaatcggc tctccgagct       360
     aaagagaatt acccggtggc aatcaataac cttgcttttg cgcaagagcg cttactagaa       420
     aacgaggagg cttgtgccct ttatcgcaaa gcactcgttc tcgaccctaa aaacaaaact       480
     gcacgcaagc ggttgaaccg cttggaacgt gcagcgtcaa aaagcaaaaa ttcgagtcaa       540
     gcttcaccaa agagcccgga tgggcgcgga ttctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page