(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE562

CP000435.PE562       Location/Qualifiers
FT   CDS_pept        complement(556567..556746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47693"
FT                   /db_xref="GOA:Q0ICM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM1"
FT                   /protein_id="ABI47693.1"
FT                   /translation="MRNRAKLGEKTDAQKLEQTKNVIGDFAIFMGLIGLGMMREGILWS
FT                   WGVLALSVIIYRSQ"
     ttgcgcaatc gggcaaagct tggtgaaaaa actgacgctc agaagctgga gcaaaccaag        60
     aatgtgatcg gcgacttcgc catcttcatg ggcttgattg gccttgggat gatgagagag       120
     ggcatcttgt ggagttgggg cgtccttgcc ttgagcgtga tcatctatcg ctcccaatag       180
//

If you have problems or comments...

PBIL Back to PBIL home page