(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE563

CP000435.PE563       Location/Qualifiers
FT   CDS_pept        complement(557079..557297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM0"
FT                   /protein_id="ABI45965.1"
FT                   /translation="MESKGLIQMKSHGLYGQPISKDEAKNQFKEICLLRQDFLAQNPYA
FT                   RKGEAMDWAIESYFSGIKSRSEKSIAV"
     ttggagtcga aagggcttat tcaaatgaag tctcatggtc tttacggaca gcccatcagc        60
     aaagatgaag ccaaaaatca attcaaagaa atttgcctgt taagacaaga ttttttagct       120
     cagaacccct acgcaagaaa aggcgaagcg atggattggg ccattgagtc ttacttttca       180
     ggaatcaagt ctagatctga aaaatcaata gccgtctaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page