(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE572

CP000435.PE572       Location/Qualifiers
FT   CDS_pept        complement(563277..564272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0593"
FT                   /product="dihydrouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46998"
FT                   /db_xref="GOA:Q0ICL1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL1"
FT                   /protein_id="ABI46998.1"
FT                   /translation="MLLKIQGRLLERQLRCRALQSPLAGVSDRIFRQLVRRWAPDALLF
FT                   TEMVNATSLELGHGRLKMDGLQEETGPIGVQLFDHHPDAMADAARRAADAGAFLIDINM
FT                   GCPVRKIARKGGGSGLIRDPDLACRIVDTVVAAVGLPVTVKTRLGWCGEHNAVKAQAAV
FT                   NWCRRLEEAGARMLTLHGRTREQRFSGTADWNAIAAVKAALSIPVIANGDVNSPEEALR
FT                   CLRITGADGVMVGRGSMGAPWLVGQIDAALSDRPIPATPKPLARLALAKEQLLALIEAR
FT                   GDHGLLIARKHMSWTCTGFHGASQFRQQLMRAPTPAAALDLLDQQMLRME"
     atgctgctga agattcaggg tcgactctta gagcgacaac tcagatgccg cgcactgcaa        60
     tcccccctgg ctggcgtcag cgatcggatt tttaggcaac tggtgcgccg ctgggctccc       120
     gatgcattgc tgtttaccga aatggtgaat gccaccagcc ttgagctggg acatggacgg       180
     ctaaaaatgg acggcctgca ggaagaaaca gggcccatcg gggtgcagtt gtttgatcac       240
     catcccgacg cgatggcaga tgcagcccgt cgtgcggccg atgccggagc ctttctgatc       300
     gacatcaata tgggctgtcc tgtacgcaaa atcgcccgaa aaggaggcgg cagcgggctg       360
     attcgcgacc cggatctggc ctgcagaatt gtcgacaccg tggtagccgc agtagggctt       420
     ccggtcacgg tgaaaacccg tctcggctgg tgtggtgaac acaatgcggt aaaggctcag       480
     gccgccgtga actggtgccg acgcttggag gaggcaggag cgcgaatgct gacgctccac       540
     gggcgcacgc gcgagcaacg cttcagcggc actgcggatt ggaatgccat tgctgctgtc       600
     aaagcagccc tcagcattcc cgtgatcgcc aatggggatg tcaacagccc tgaggaagcg       660
     ctgcggtgct tgcgtatcac cggcgccgat ggcgtgatgg tgggtcgcgg aagcatgggt       720
     gccccttggc ttgtgggcca aatcgatgcc gcactcagtg atcggccgat tccagccacg       780
     cccaaaccgc ttgcgcgctt agccctcgcc aaggaacaac tcctggcgct gatcgaggca       840
     cgcggagatc acggactctt gattgcccgg aaacacatga gctggacctg cactggcttc       900
     cacggcgcat cccagtttcg gcaacagctg atgcgggccc ccacgcctgc cgcggccctt       960
     gatttgctcg atcaacagat gctgcgaatg gaatga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page