(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE576

CP000435.PE576       Location/Qualifiers
FT   CDS_pept        567208..568122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0597"
FT                   /product="possible cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47052"
FT                   /db_xref="GOA:Q0ICK7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK7"
FT                   /protein_id="ABI47052.1"
FT                   /translation="MDWLRQIPIGQYVDGSAGWLRLLDPRLKLGWVVMFLLTPVLAGPL
FT                   WRLGLVLALLVITALSGLPARLWWRSLLLVLCLGVGFGLLAMFLPTGDPAATLAVRPVQ
FT                   ELQGLSLQTSSWELFRLGPVQLGPLNLGPLSVDRRSAELGLNSATLIVTVVHSVNLMLL
FT                   STPSEDLMWALNWFLFPLTKLGLPVDRLCFQLLLALRFLPLVQEELQNLVRSVASRAVN
FT                   LRQLGLKASFGLILSVGERLLANILLRAEQGADALIAKGGRWLPADCFRPVQSTSALAR
FT                   GLNLLSFVVLLAVVGLRGKYGAF"
     atggactggt tgcgacagat tccgatcggg cagtatgtcg atggcagtgc tggttggctg        60
     cgtctgctcg atcctcgttt gaagctgggc tgggttgtga tgtttttgct gaccccagtg       120
     ctggcgggcc ctttgtggcg tctcgggctc gttctggcct tgttggtgat caccgctctg       180
     agtgggttgc cggccaggtt gtggtggcgc tctctacttc tggtgttgtg tctcggtgtt       240
     ggctttggcc tcctggcgat gtttttgcca acgggagatc cagccgccac gttggcggtt       300
     cggcctgtcc aggagttaca gggtttatct ctgcaaacgt ccagctggga gttgtttcgc       360
     cttggtcctg tccaacttgg gccactcaac ctgggcccgc tgtccgtgga tcggcgatca       420
     gctgagcttg gtctgaatag cgccacgttg attgtcaccg tggtgcacag cgtgaatctc       480
     atgctgttgt ccacaccaag cgaggatctg atgtgggccc tgaattggtt tttgttcccc       540
     ctaaccaaac ttggtttacc agtggatcgt ctttgctttc agctgctgtt ggcgcttcgt       600
     tttctgccct tggtgcaaga ggaactgcag aatctggtgc gctccgtggc gagtcgagcg       660
     gtcaatctcc gtcagttggg cttgaaggct tccttcggat tgatcctttc ggtgggggag       720
     cgacttctcg ccaatatttt gttgcgggct gagcaaggag ctgatgcctt gattgcaaag       780
     ggagggcgtt ggcttcctgc ggactgcttc cgccctgttc agagcacgtc tgccttggct       840
     cgtggtttga acctgctgtc atttgtggtc cttctcgcgg tagttggatt gcgaggcaag       900
     tacggtgcct tttaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page