(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE577

CP000435.PE577       Location/Qualifiers
FT   CDS_pept        568141..568407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0598"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46107"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK6"
FT                   /protein_id="ABI46107.1"
FT                   /translation="MGAERYLNHPTFGMLYQVSTAGEGRDLYATLYAQRMFFLVTLQPR
FT                   GAQFEVIPYQDARHHAELHLARCRRDRAADFADWKQLFDQTFI"
     ttgggagcgg agcgttatct caatcacccc accttcggaa tgctttatca ggtttcgacc        60
     gcgggcgaag gaagggatct gtacgccact ctttatgccc agcgcatgtt tttcttggtg       120
     acgctgcaac ccagaggggc tcagtttgag gtgattccat atcaggacgc tcggcatcat       180
     gcagagctcc acctggcgcg ctgtcgccgt gatcgcgctg ctgactttgc cgattggaag       240
     cagctgttcg atcaaacctt catttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page