(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE582

CP000435.PE582       Location/Qualifiers
FT   CDS_pept        complement(571821..573239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0603"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45143"
FT                   /db_xref="GOA:Q0ICK1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK1"
FT                   /protein_id="ABI45143.1"
FT                   /translation="MVGDHDSANEHILSGPSLNSPDPALPTSANPEGRRGLQAVIHLDG
FT                   FRRLWVGQIFSQLADKFYIVLMVYLIAQYWVTNTPDSNGALAEIASAIRMDFETRAQRI
FT                   TLLATGIYVANTIPAMVLGSVAGVWVDRWPKRRVMVASNGLRAVLVLCTPLFLIPGPHW
FT                   FGLSWGYWALLLMTFLESVLTQFFAPAEQATIPLLVPREHLLAANSLYQATSMGATIVG
FT                   FALGDPILRGLNHLLQTVGINGGEFLLLPFCYGMAAISLSTIQMREPPRKDSSDSVWKE
FT                   IVAGIQVLREQSSVRGAMVHLVVLYSLLAALYVLAISLASAIQGLGPTGFGSLLAMSGL
FT                   GMAIGAVLVAQMGHRFSRRRLAAAGLGTITWCLVMLGQLRGNLSITLTLCGVLGIGAAL
FT                   VAIPAQTTIQEDTPESQRGRVFGLQNNLINIALSLPLVLAGALVSSIGLIPVLWVLAAL
FT                   SLAAALWERPWERC"
     gtggtgggcg atcatgattc cgcgaatgaa cacattttga gcggtccttc tctaaacagc        60
     ccggacccgg ccctgcccac gagcgccaat cctgaaggtc gccgcggcct tcaggccgtg       120
     atccatctcg atggcttccg acgcctgtgg gtcggacaga tcttctccca actcgcggac       180
     aagttctaca tcgtgttgat ggtgtatctc atcgcccaat actgggtgac caatacaccg       240
     gacagcaatg gcgctcttgc tgaaatcgcc tctgcgattc gcatggattt cgagacgcgc       300
     gcccagcgca tcacattgct ggccaccgga atttatgtcg ccaataccat cccggcgatg       360
     gtgctcggtt ctgttgccgg tgtgtgggtc gaccgctggc ccaaacgcag agtgatggtg       420
     gcctccaatg gcctgagggc agtgctcgtg ctttgcaccc ctctgttcct gatccctggg       480
     ccccactggt ttgggctgag ctggggctat tgggctctgc tgctgatgac ctttcttgag       540
     tcggttctga cccagttttt cgcccccgct gaacaggcga caatcccact gctggtaccg       600
     agagaacacc tgctggccgc caactctctc tatcaagcca caagcatggg ggccacgatc       660
     gttggctttg ccctaggcga tccaatcctg cgaggactca accacctgct tcaaacggtg       720
     ggcatcaacg gtggcgaatt tctgcttctg ccgttctgtt acggcatggc ggccatcagt       780
     ctgagcacca tccagatgcg cgaaccgccg agaaaggaca gcagtgattc cgtctggaaa       840
     gaaatcgtgg cgggaataca ggtgcttcga gagcagtcat cggtccgcgg agccatggtg       900
     catctcgtgg tgctttacag cctgctagct gcgctttatg tgctggcaat cagcctggcg       960
     tctgccatcc aaggactggg gccaacaggt ttcggcagcc tgctggcgat gagcggatta      1020
     gggatggcga ttggcgctgt gttggtggcc caaatgggcc atcgttttag ccgtcgacgc      1080
     ctcgccgcag ccggactagg cacgattacc tggtgtttgg tcatgctcgg gcaactgcgc      1140
     ggaaatctca gcatcacctt gaccttgtgc ggcgtcctcg gaattggagc cgctctcgtg      1200
     gcaattcctg ctcagaccac gattcaggag gacaccccag aatctcagcg aggtcgggtc      1260
     ttcggacttc agaacaacct gatcaacatt gctctcagcc tgcccctggt tctcgccggt      1320
     gccctggtga gcagcattgg cttgatccct gtgctctggg tgcttgcggc actttcttta      1380
     gctgccgctc tttgggagcg gccttgggag cgctgctag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page