(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE588

CP000435.PE588       Location/Qualifiers
FT   CDS_pept        complement(578128..578658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45730"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ5"
FT                   /protein_id="ABI45730.1"
FT                   /translation="MNPFSLAFLSLVIILASPLSAPAQMRMLSRSNMSGQNRVSNGREH
FT                   ITNKNDRIMEMDGQMDSQVVTFTMSDEGIEAPVTELMIQNLEQVRPGDTTSEEKLKLGI
FT                   TKEGELAGMTNSEIITEDGFAMTATMTINEQNVNMHQKTVEETFIETIEDFSTTSNSAA
FT                   FSSGSGFSGNFDF"
     atgaatcctt tcagtctagc ttttcttagt cttgtgatta ttcttgcatc gcctctttcg        60
     gcccctgctc agatgagaat gcttagcaga agcaatatgt caggacaaaa tagagtatct       120
     aacggcagag aacatataac caacaagaat gatagaatca tggagatgga tggccaaatg       180
     gacagccaag tcgtgacttt tacgatgtca gatgaaggca ttgaagctcc agtcaccgaa       240
     ttgatgattc aaaatcttga acaagtgcgt ccaggagaca ctacttcaga ggaaaagctg       300
     aagctaggaa tcaccaaaga aggcgaactt gctggaatga caaatagcga aataatcact       360
     gaagatggtt ttgcgatgac agcaacaatg accattaacg aacaaaatgt caatatgcat       420
     caaaagacag tagaggaaac ttttattgag accattgaag actttagtac tacatccaac       480
     tcggcagcat tttcatcagg atcagggttc agcggtaatt tcgacttcta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page