(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE596

CP000435.PE596       Location/Qualifiers
FT   CDS_pept        588039..589172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0617"
FT                   /product="2-oxo acid dehydrogenases acyltransferase
FT                   (catalytic domain) protein"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45271"
FT                   /db_xref="GOA:Q0ICI7"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI7"
FT                   /protein_id="ABI45271.1"
FT                   /translation="MPAGSTAPVGETIGLIVETEAEIADVKAKAPSSAPAAPAAAAPPA
FT                   APAPPTPVSAPAAVSAPAPVTAPVAASVSNGRLIVSPRARKLASQMGVDLAGLRGTGPN
FT                   GRIQAEDVEKAAGRPVTPPRVGEGTSAAAVVGDTVSASPSAPSGNSFGAPGDTVAFNTL
FT                   QAAVNRNMEASLAVPCFRVGYTITTDKLDAFYKQVKLKGVTMTALLAKAVAVTLARHPQ
FT                   VNAATTASGMSYPAEVNVAVAVAMEDGGLITPVLRNADRTDLYELSRQWGDLVKRSRSK
FT                   QLQPEEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQ
FT                   MQVNLTADHRVIYGADGAAFLKDLAELIDTRPESLAL"
     atgcctgcgg gtagcactgc acctgtgggt gaaacgattg gcctgatcgt tgagacggaa        60
     gctgagatcg ctgatgtgaa ggccaaagct ccttcttcag ctccggccgc tccagctgca       120
     gccgcccccc ctgcggctcc agcgcccccc actcccgttt cagctcctgc tgccgtttca       180
     gctccagctc ccgtcacagc tccggtggct gcatctgtca gcaacggacg cttgatcgtc       240
     agtccccgcg cccgcaagct tgcctcccaa atgggtgtag accttgctgg tctgcgcggt       300
     actggcccca atggccggat tcaggcggaa gacgttgaaa aggcagccgg acgtcctgtg       360
     accccaccac gggtaggtga agggacttca gccgctgccg ttgttggtga cacagtctcg       420
     gcttcaccgt cggctccttc gggcaacagt tttggcgccc caggcgacac cgtggccttc       480
     aacaccctgc aggcggcggt gaaccgcaac atggaagcca gtcttgcggt gccttgtttc       540
     cgtgttggat acacgatcac taccgacaag ctcgatgcct tttacaagca ggtaaaactc       600
     aaaggcgtca cgatgacggc ccttctggcc aaagctgtgg ccgttacttt ggctcgccat       660
     ccccaggtga atgccgcaac cacggcttct ggcatgagct accccgctga ggtgaatgtg       720
     gctgttgctg tggcgatgga agacggaggc ttgattacgc cggtattgcg caatgccgat       780
     cgcaccgatc tatatgagtt gtcgcgtcag tggggggatt tggtgaagcg ttctcgcagt       840
     aagcaactgc agcctgagga atacagcacc ggcaccttca ccctctccaa ccttggaatg       900
     ttcggagtgg atcgatttga tgccattctg cccccaggca ccggcgcaat cctggcggtt       960
     gcggcgtctc gtcccaccgt ggtggcaggc aaagacggat ccatcgccgt gaagcgtcag      1020
     atgcaggtga atctcaccgc tgatcaccgc gtgatttatg gcgccgatgg tgctgccttc      1080
     ctcaaggatc ttgcggaact gatcgacacg cgtccggaga gtttggctct gtaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page