(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE597

CP000435.PE597       Location/Qualifiers
FT   CDS_pept        589182..591104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0618"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45859"
FT                   /db_xref="GOA:Q0ICI6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI6"
FT                   /protein_id="ABI45859.1"
FT                   /translation="MFAASLFSRLIGRALPRAQAARERLPNLQALPILSSDALSSVAYA
FT                   TEASLGVLILAGSSALKQSLPITLAIIALIVIVVLSYRQAISAYPNGGGSYVVARENLG
FT                   RNISLVAAAALLIDYTLTAAVSLMAGTQALSSLLPSLLPHELSLSLLLLALVGWANLRG
FT                   IREAGRIFAIPTYVFVVMILLLTLVGLTDLSFQHGWTPEPPPLEAALQPLGLFLILRAF
FT                   SSGCSAMTGIEAISTGVQVFREPAARNARVTLLVMGGLLASMLLAVTGLGFMYGIAPDS
FT                   QVTVLAQIGIRVFGSGSILFWLLQLSTLLILVLAANTAFAGFPLLAAMLAEDRCLPPQM
FT                   RWLGDRLVYQNGIGVLLAVSALIIWICHGDTTVAVNLYALGVFTAFTLSQLGLVLHWFR
FT                   MRGPGWQGRMALNALGALSTFVVLLVIIVSKFTEGAWSVVIALPLVVWGLALIRRRSRE
FT                   VLALLAPDPRMEPLFLEPKASLPRHHAIVWLGGFNQPSFEAVRYACSIADKVTAVMVLS
FT                   DQQDADQIGAEWDRCAGTQTGALDFQCLESPFSSLLQPFCDFVVEQERNHPELCTTVVM
FT                   PVVVPRDRLDQTLLNQRALNLFTALSAGKSRVFSIVRFYISPAGKKDNAALAACPDVVV
FT                   KPDDA"
     gtgtttgctg cttcattgtt ttcacgcctg atcggacgag cgttgcctcg tgctcaagca        60
     gcccgggagc gactgcccaa cctgcaggct ctgccgatcc tgtcgtcgga tgcactctcc       120
     tccgtggcgt acgcgacaga ggcgtccctg ggtgtgctga tcctggcggg tagttcggcc       180
     ctcaagcaat cgctccccat caccctggcg atcattgctt tgatcgtgat tgtggtgctg       240
     tcctatcggc aggcgatctc cgcttatccc aatggcggcg gctcttatgt agtggctcgt       300
     gaaaacttgg gacgcaacat cagccttgta gccgcggcag cccttttgat cgactacacc       360
     ctcactgctg ccgtgagctt gatggctgga actcaggccc tgtcgtcttt gctgccctca       420
     ttgcttcccc atgagctgtc gttgtcactt ctgctgttgg ccctggtggg ttgggccaac       480
     ctgcgcggca ttcgtgaggc gggccggatt tttgccattc ccacctatgt ctttgtggtg       540
     atgatcctgc tgctcaccct tgttgggcta actgatctca gctttcaaca tggctggacc       600
     cctgagccac ctcctttaga ggccgctttg cagcccttag ggctgttttt gatcttgcgg       660
     gcttttagtt ctggttgttc agcgatgaca ggcattgagg ccatttccac tggcgtgcag       720
     gtgtttcgtg aacccgcggc gcgcaatgct cgcgtgacgc tgctcgtgat gggtggtttg       780
     cttgcgtcga tgctcctagc cgtgactggc ttggggttca tgtacggcat tgcgccggat       840
     tcgcaagtca ccgttttggc tcagatcggc attcgggtgt ttggcagcgg cagcatcttg       900
     ttttggctgc tgcaactctc caccctgctg attctggtgt tggccgccaa cacggctttt       960
     gctgggtttc ctttattagc ggcgatgctt gccgaagacc gttgcctgcc accgcagatg      1020
     cgttggttgg gagatcgctt ggtgtatcag aacggcattg gcgtgttgct ggcggtgtcg      1080
     gcgttgatca tttggatctg ccacggagac accaccgtgg cggtcaattt gtatgcattg      1140
     ggtgtgttta cggcgttcac gttgtctcag ctgggattgg tgctgcactg gtttcggatg      1200
     cgtggaccgg gttggcaggg acggatggcg ctgaatgctt tgggtgccct ctccacgttc      1260
     gtggtgttgt tggtgatcat cgtgagcaag ttcacggaag gcgcctggtc ggtggtgatt      1320
     gctctgcctc tcgtggtgtg ggggctcgcc ttgattcgcc ggcgctcacg ggaggtactg      1380
     gctttactgg cgcctgaccc gcgcatggag cctctttttt tagagccgaa ggcatcgttg      1440
     ccacgccatc acgccatcgt ttggcttggt ggtttcaacc agccgtcctt tgaagccgtc      1500
     cgttacgcct gttccatcgc cgacaaggtg acggctgtga tggtgttgtc tgatcaacag      1560
     gatgctgatc agatcggtgc cgaatgggat cgctgcgctg gaacgcaaac cggcgccttg      1620
     gatttccaat gtcttgagag tccgttcagc tcgcttctgc agcccttttg tgattttgtt      1680
     gttgagcagg agcggaatca tcctgagctc tgtacgacgg tggtgatgcc agtggtcgtg      1740
     ccaagggatc gattggatca aacccttctg aatcagcggg ccttgaattt gtttaccgct      1800
     ctctctgccg gtaagagtcg cgtcttttcg attgtgcgct tctacatttc gcctgccggg      1860
     aagaaagaca acgctgcctt ggcagcatgc cctgatgttg tggtgaagcc agatgatgcc      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page