(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE605

CP000435.PE605       Location/Qualifiers
FT   CDS_pept        598109..598393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20369.1; match to
FT                   protein family HMM PF07864"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47038"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH8"
FT                   /protein_id="ABI47038.1"
FT                   /translation="MLSMSMGCFADVGVEGWLTDRCGYWAMRFHRDEQSDENDPRIFVD
FT                   YGRGMPNGQSAFLKSRKHLPRKDAETQWNRLIEIGWTQVPPVWGQGIEP"
     ttgttgtcaa tgagtatggg ttgcttcgcc gatgttggtg tggagggttg gttgaccgat        60
     cgctgtggtt actgggcaat gcgctttcat agggatgagc agtctgatga gaatgatcct       120
     cgtatttttg tggattatgg aagggggatg ccgaacggac agtccgcctt tttgaagagc       180
     agaaaacatc tgccacgaaa ggatgcagag acgcaatgga atcgattgat tgaaatcggt       240
     tggacgcagg ttccacctgt ttggggtcaa ggtattgagc cataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page