(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE616

CP000435.PE616       Location/Qualifiers
FT   CDS_pept        607419..607826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG7"
FT                   /protein_id="ABI45056.1"
FT                   /translation="MVKVVFRKVPDYIVKARASYQLQRGVPCDCQSHVGKKQWKEPGGT
FT                   TLKEAHARGLRKRVRDEKGLCSNSVAVLAWLWITLQPLIRCRMADIAGRKSDHIHDDSL
FT                   LIEDHSASSATSRDGGVDWTRFVKKIAFLAQ"
     ttggtcaagg tggtcttccg aaaggttcct gactacatcg tcaaagcacg ggccagctac        60
     cagctgcagc gtggtgtgcc ctgcgattgt cagtctcacg ttggcaagaa acagtggaaa       120
     gagccaggtg gcacaacgct gaaagaggcg catgcccggg gcctgcgcaa gagggtgagg       180
     gatgagaagg ggctctgttc aaactcagtg gcagtcctgg cttggttgtg gatcaccctc       240
     cagcctttga ttcgctgtcg tatggctgac attgccggcc ggaaatctga tcacatccat       300
     gacgactctc tattgattga ggatcacagt gcatccagtg ccactagccg tgatggagga       360
     gttgattgga ctcgttttgt gaagaagatt gcttttcttg cacaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page