(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE62

CP000435.PE62        Location/Qualifiers
FT   CDS_pept        complement(65184..65879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46737"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE21"
FT                   /protein_id="ABI46737.1"
FT                   /translation="MAAADHLSVPRQHGLFLHHGIDLGDGTIAHYLEGREILRSPLEEF
FT                   KRGLETSVVEHDHPSPAGVTLRRAMSRIGEQRYNLLFNNCEHFASWCKTGRHQSGQVEN
FT                   FLHTTSLGALAIGQLMPAALLTGLRLLLKQGLVNKQSRDRARRGLLQLKKLRESLLDQL
FT                   EGTLEQAEGWIRGGPNNGASDRYGGQSRKLLKAGQSLADELAALEELEQRISDLLNEQH
FT                   GPSISDQAE"
     atggctgccg ctgaccatct ttcagttcca cgccaacacg gtttatttct gcatcacggc        60
     atcgatctgg gcgatggcac catcgcccat tacctcgagg gacgagaaat tctgcgcagt       120
     ccgttggagg agttcaaacg cggattagaa accagcgttg ttgagcatga ccatccatct       180
     ccagcgggcg tcacactgcg gcgcgcaatg agtcgcatcg gcgaacagcg ctacaacctg       240
     ctcttcaaca actgcgaaca cttcgccagc tggtgcaaaa ccggccggca tcagagcggt       300
     caagtggaga acttcctgca caccaccagc ctcggcgctt tggcaatcgg ccagctgatg       360
     cccgcagcgc ttctcacggg actccgattg ctcctgaagc aggggttggt gaataaacaa       420
     tcccgagatc gcgctcgccg cggcctctta cagctaaaaa aactccgtga aagtttgctc       480
     gaccagctgg aaggcacgct tgagcaggca gaggggtgga ttcgcggcgg ccccaacaat       540
     ggcgccagcg atcgctacgg aggacagagc agaaagctac tcaaagcagg gcaaagcctc       600
     gccgatgaac tcgcagcctt agaagaactc gagcaacgca tcagcgattt gctcaacgag       660
     caacatgggc cttccatcag cgatcaagct gagtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page