(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE623

CP000435.PE623       Location/Qualifiers
FT   CDS_pept        complement(611383..611994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0644"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47497"
FT                   /db_xref="GOA:Q0ICG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG0"
FT                   /protein_id="ABI47497.1"
FT                   /translation="MAYVFVHLLPELASHGQAISEAPGMKTFAPTPITEALLFLIALVG
FT                   IMLTYSLDVLATHERQAGRVASSLHTLNFAAISYLYAYSLPSLISTGLAYGVLFTIAIC
FT                   AHVLLADRTMAARHPATFRTRTRWFGTAALVLGLLHAALFHPVADLHLAIATAFIGGGL
FT                   LIAVFREELPAVNRTRLGWFVAGTVSMTSLLLLALTHATH"
     atggcctacg tctttgtgca cttattgcca gagcttgcca gtcatggcca agccatctcg        60
     gaagcccctg ggatgaaaac ctttgcccct accccgatca cagaagcgtt gctatttctc       120
     atcgccctcg tgggaatcat gctgacgtac agccttgacg tgcttgccac ccatgagcga       180
     caggctggaa gggttgcaag ctcactgcac actctcaatt tcgcagcgat cagctacctc       240
     tacgcctatt cccttccatc cctgatcagc accgggttgg cctacggagt gttgttcacc       300
     attgccatct gcgcccatgt tctcctagcc gatcggacca tggccgcccg tcatcccgcc       360
     accttccgga cacgtactcg ctggttcgga accgcagccc tggtcctggg cctgttgcat       420
     gcagcactct tccacccagt ggccgacctc catctcgcca tcgcaacggc atttattgga       480
     gggggactgc tgatcgccgt gttccgagaa gagctcccgg cagtgaatcg cacgcgcctt       540
     ggctggtttg tggctggaac cgtatcaatg accagtcttc tgcttcttgc tctcacccat       600
     gccactcact ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page