(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE624

CP000435.PE624       Location/Qualifiers
FT   CDS_pept        complement(612038..612175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF9"
FT                   /protein_id="ABI45935.1"
FT                   /translation="MFGFRKEATLKQSLGVGSSALDLFNYLRDGDRQCSLARKQDGNST
FT                   "
     atgtttggct tcagaaaaga ggccacactg aaacagtctt taggcgttgg cagcagtgct        60
     ctggatctct tcaattattt gcgtgatggc gatcgccagt gctcattggc tcgcaagcaa       120
     gatggcaact caacctga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page