(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE626

CP000435.PE626       Location/Qualifiers
FT   CDS_pept        complement(613335..613580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0647"
FT                   /product="NifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46656"
FT                   /db_xref="GOA:Q0ICF7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF7"
FT                   /protein_id="ABI46656.1"
FT                   /translation="MSTETMALTNENVEKVLDELRPFLMADGGNVEVVEIDGPVVKVRL
FT                   QGACGSCPSSTMTLKMGIERKMRESIPEVSEVVQVL"
     atgagcaccg agaccatggc cctcacaaac gagaacgtgg aaaaagtgct tgatgaacta        60
     cgacccttct taatggccga cggtggcaat gtagaagttg tagaaatcga tggaccggtc       120
     gtaaaagttc gcctgcaggg cgcttgcgga agctgcccca gcagcaccat gactttaaag       180
     atggggattg aacgcaagat gcgcgaatcg attcccgagg tgagcgaagt cgttcaggtt       240
     ctatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page