(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE629

CP000435.PE629       Location/Qualifiers
FT   CDS_pept        complement(616319..616645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46977"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF4"
FT                   /protein_id="ABI46977.1"
FT                   /translation="MDLPHIPLGWIKPALSVAASLTMAAPFATSAFSCELHQPQQLKDG
FT                   TPLKEQTTQFVPEDHKGMVCMAIAPQCMTKKQWAAHCLSQNNAIESKSCRDALDRPDPN
FT                   PEAI"
     atggatctcc cgcacatccc ccttggatgg atcaaacctg ccctgagcgt ggccgcatcc        60
     ctgaccatgg cggcaccttt cgcaacatca gctttttcat gtgagctgca ccaaccccag       120
     cagctaaagg atgggacacc cctcaaagag cagaccaccc agtttgttcc tgaggatcac       180
     aaaggaatgg tttgcatggc gatagcacct caatgcatga caaagaagca gtgggcggct       240
     cattgcctca gccaaaacaa tgcgatcgaa tcgaaaagct gccgtgacgc actcgatcga       300
     cccgatccaa acccagaagc aatctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page