(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE630

CP000435.PE630       Location/Qualifiers
FT   CDS_pept        complement(616654..616983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0651"
FT                   /product="possible drug resistance protein"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46248"
FT                   /db_xref="GOA:Q0ICF3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF3"
FT                   /protein_id="ABI46248.1"
FT                   /translation="MPAPWILLMLAIGSEVIGTSCLKLSEGFSRPIPTLVVLAAYSTSM
FT                   LLLSRVVQTIPLGITYALWSGIGIIAIVLVGLLAYKQVPSPGQLVGIATITAGVIIVNL
FT                   TGKHP"
     atgcccgcac cctggattct gttaatgctg gcgatcggtt ccgaagtgat tggaacctcc        60
     tgcctcaaac tctctgaggg tttcagcagg ccaattccca cactcgttgt gctggccgct       120
     tactccacct cgatgctgtt gctctctcga gtggtgcaga ccattcctct cggcatcacc       180
     tacgccctat ggagtggaat cgggatcatc gccatcgtgc tggttggctt gcttgcctac       240
     aagcaagttc cctccccagg tcagctagtg ggaatcgcca caatcacagc tggggtgatc       300
     atcgtgaatc tcactggcaa gcatccctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page