(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE633

CP000435.PE633       Location/Qualifiers
FT   CDS_pept        complement(620827..621405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45896"
FT                   /db_xref="GOA:Q0ICF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF0"
FT                   /protein_id="ABI45896.1"
FT                   /translation="MSMRGIRSGGFTMLEVLVIATIAALTASWMLPTFRRQRLQGEVDQ
FT                   YSRLVEVGLFNLRTRLREERLSHCICFEANNWAPPSSMGLERQQPDGSQAEPLNHCSEE
FT                   DPSSRLRVMNLEGSRMSKTVQARSLESKFCISPPGTSATPQTLTLLLKSIQSDSDPNLL
FT                   VRCLHMNGNGYLIRGNWNQSTQTCQPKWG"
     ttgtcgatga gaggcataag gtcgggtggc ttcacaatgc tggaggttct cgtgatcgcg        60
     acgattgcag cgctcacagc aagctggatg ctaccgacat ttcgtcgtca acgtcttcag       120
     ggagaagttg accagtactc gcgtctcgtc gaagtaggcc tttttaatct gcgcacgcgc       180
     ttgcgtgaag agcgcctctc acactgcatt tgctttgagg caaacaattg ggcgcctcca       240
     tcatcaatgg gattagagcg gcaacaacct gatggaagcc aagccgaacc tctgaatcat       300
     tgcagcgaag aagatccttc tagccgtctg agggtcatga atttagaggg aagtcgcatg       360
     agtaaaacag tgcaagcacg atctctggaa tcgaaatttt gcatcagtcc accggggaca       420
     agtgccactc ctcagacgct cacgcttcta ctgaaatcga tccaaagcga ttctgaccca       480
     aacctgttgg tgcgatgcct acacatgaat ggcaatggct acttgatacg aggcaactgg       540
     aaccaatcga cgcaaacatg ccaacccaaa tgggggtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page