(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE634

CP000435.PE634       Location/Qualifiers
FT   CDS_pept        complement(621396..621785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE9"
FT                   /protein_id="ABI47090.1"
FT                   /translation="MIGISRVSISALTRTSIEQQRSRIEAEINSNMQLIQQANSRLTLE
FT                   SIPPLDRERACSAPEAYLISRINQAGATQHVPRPAMAERTFTITSLGEGWDVIEVAYQF
FT                   QAPEQTISTEQRMVELHPTFAPRCR"
     atgatcggca tcagcagagt ctcaatctct gcactcacca gaaccagcat cgaacaacag        60
     cgaagtcgta tcgaagcaga gatcaacagc aatatgcaac tcattcagca agcgaatagt       120
     cgtctcaccc tggaatccat cccacccctc gatcgagagc gagcgtgctc ggcaccagaa       180
     gcctatttaa tttcccgaat taatcaggct ggcgccactc agcatgttcc acgaccagcc       240
     atggccgaac gcacattcac gatcacctct ctaggagagg ggtgggatgt cattgaagtc       300
     gcttatcaat tccaagcacc agagcaaacc atctccacag aacagagaat ggttgaactt       360
     catccaacct ttgctccccg ttgtcgatga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page