(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE641

CP000435.PE641       Location/Qualifiers
FT   CDS_pept        complement(625928..627517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45594"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE2"
FT                   /protein_id="ABI45594.1"
FT                   /translation="MARKQFLSTIPRKPQKQNGFAGMSELIIASGVGTLLIMASGAALR
FT                   STGTLIKQSEVKTTLRQNSINGLRLMRSEVERSMHLVLNKTESTSEDQAHINLSDSRYS
FT                   SLLSECAALAGNSLFKPMFGVKMVELTKPVLYGVSIGSGGYSIERCGAPLDPGGKYKET
FT                   ENLFLSRVIDHVGAIPCRQKSELNQGESLSTACEDNAPTLAQILASTNFTFTAGKTPNR
FT                   SERQPGLRIETDTNYKLIKFIDPTQSTEDSITQSFINKLGVGDKQLTEQPLYFTAFARA
FT                   DKRIGNFGDDGQGGPLSGAFFQNITSNKVRFAVDGSGSMSACVMWGEGYGTWRTFYDPK
FT                   EGRYRDTRRICALTRMEALISEMTMILDQLPVNTKVGITSFSSDGYMNNREWSESSNGL
FT                   VRIGNEGKRDSAIAFVNTLDDSKVTKWGGTYPWKAIQKAFDDTETDTLYLMSDGQPNRD
FT                   RNGGGWSNWDHQSTADYYANENHDRNHNGKDRALIVNSTSLGLESRWLEMLSEKTQGYY
FT                   NQIDKENLQENS"
     atggcacgaa aacaatttct atccacgatt ccacgtaaac cacagaagca gaatggtttc        60
     gctggcatga gtgagctaat aatcgcatct ggcgtcggaa cgcttttaat catggcttcc       120
     ggcgccgcat tgcgatccac tggaacattg attaagcagt cagaagtaaa aacaaccctt       180
     cgccagaatt caatcaatgg cttgagatta atgcgatcag aggtggaacg cagtatgcat       240
     ctagtgctca acaaaacgga aagtacttca gaggatcaag cgcacatcaa tctcagcgac       300
     agtcgctata gctctcttct cagcgaatgt gcagctcttg cagggaatag cctctttaag       360
     ccaatgtttg gtgtaaagat ggttgaatta actaagccag tactttacgg agtcagcatt       420
     ggatcaggcg gctacagcat cgaacgctgt ggagcaccac ttgatcctgg tggcaaatac       480
     aaagaaacgg aaaatctctt cttatcacgt gtcatcgatc acgttggagc cattccctgc       540
     cgccagaaaa gcgagctcaa tcaaggggaa agtttgtcca cagcctgcga agacaatgct       600
     cccacattgg cacagattct tgcaagcaca aactttacat ttacagccgg aaagactcca       660
     aaccgcagtg aacgacaacc gggacttcga atcgaaacag atacaaacta caaacttata       720
     aaattcatag atcctaccca atcaacggaa gacagcatca ctcagagctt catcaataag       780
     ctgggagttg gtgacaagca actaaccgaa cagccccttt atttcactgc cttcgcaaga       840
     gcggacaagc gcattggcaa cttcggagac gacggtcaag gaggaccctt gagtggtgca       900
     ttcttccaga acatcaccag caacaaggtg cgctttgcag tcgatgggtc gggctccatg       960
     agtgcctgtg tgatgtgggg tgagggctat gggacttggc gcaccttcta cgatcccaaa      1020
     gaaggtcgct accgcgacac gcgtcgaatt tgtgctctca ctcggatgga ggcactcatc      1080
     agtgagatga cgatgatcct ggatcaattg ccggtaaaca ccaaagtggg catcacctct      1140
     tttagttcag atggttacat gaacaacagg gaatggagcg aatcaagcaa tggcttggta      1200
     aggattggaa atgagggcaa gagagattca gcgattgcct ttgtaaacac tcttgatgat      1260
     tcaaaagtaa ccaaatgggg aggtacttac ccatggaaag caatacaaaa agcctttgat      1320
     gatacagaga cagacactct ctacctcatg tctgatgggc aacccaatcg agacaggaat      1380
     ggtgggggat ggtccaattg ggatcatcaa tcaacagcag attactacgc aaatgaaaac      1440
     catgacagaa accataatgg caaagatcgc gctcttattg tcaactccac atcgcttggt      1500
     cttgagtcaa ggtggttgga aatgctgtca gaaaagacac aaggctatta caatcaaatc      1560
     gacaaggaaa atctgcaaga aaacagctaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page