(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE71

CP000435.PE71        Location/Qualifiers
FT   CDS_pept        75518..76291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20244.1; match to
FT                   protein family HMM PF04481"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46292"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE12"
FT                   /protein_id="ABI46292.1"
FT                   /translation="MSRLSLLPAELRRSLEQRSALKVIAGLMNFDQANVAMVAAAAGRG
FT                   GADLIDVACDAALVKLAIESSAGVPVCVSAVDPELFPAAVAAGAAMVEIGNYDAFYPQG
FT                   RLFDAAEVLAITRRTRELLPDVVMSVTVPHVLPLDQQEQLAVDLVAAGADLIQTEGGTS
FT                   AKPFSAGSLGLIEKAAPTLAASHSISAALQQAECAVPVLCASGLSAVTVPMAIASGAAG
FT                   VGVGSAVNRLNDELAMTAVVRGLREALGRPVISRV"
     atgtcccgcc tttctctgct gccagctgag ctccgtcgca gcctggagca gcgttctgca        60
     ctcaaggtga tcgccggtct gatgaacttc gatcaagcca acgtggcgat ggtggcggct       120
     gccgcgggtc gcggcggtgc tgatttgatt gatgtggcct gtgatgcggc gctggtcaag       180
     ctggcgatcg aatcctccgc tggtgtgcct gtttgtgtgt ctgcggtgga tcctgagctg       240
     tttcctgccg ctgtggctgc tggtgcggcc atggtggaga ttggcaatta cgacgctttc       300
     tatcctcaag gccgcctctt tgatgccgct gaagtgctgg ccatcacccg ccgaacccgc       360
     gagctgcttc ccgacgtggt gatgagcgtc acggtgcccc atgtgctgcc gctggatcag       420
     caagagcagt tggctgtgga tttggttgca gccggtgctg atctgatcca aaccgaaggc       480
     ggcaccagcg caaagccgtt cagcgctggc agccttggat tgattgaaaa agcagctcct       540
     actttggccg catcccacag catcagtgct gcgctgcaac aggccgagtg cgctgtcccc       600
     gtgctctgcg cctctggatt gtctgctgtc accgtgccaa tggccattgc ttctggtgcc       660
     gctggtgtag gagtgggatc agcggttaat cgcctcaacg atgagctggc gatgaccgct       720
     gtagtgcgcg ggctgcgcga ggctttgggg cgtccagtga tcagccgcgt ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page