(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE72

CP000435.PE72        Location/Qualifiers
FT   CDS_pept        76413..76838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47487"
FT                   /db_xref="GOA:Q0IE11"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE11"
FT                   /protein_id="ABI47487.1"
FT                   /translation="MMGTLGWLLQWPIRALVLLVVAALPLGVELASFGTALWAAVLIGL
FT                   LGTLLILPLKVVMGPVWAITSLGGLISPVSFLFNWLITVILFGLAAWLIPGFRLKNGLI
FT                   SAIGGAVIYSVISAVVLRALGLADVDFTRAALIGSLA"
     gtgatgggaa cgcttggctg gttgctgcaa tggccgattc gagccctggt gttgctggtc        60
     gtagcagcgc ttccgcttgg tgtggaactg gccagctttg gtacggcact ctgggcagcg       120
     gtgttgattg gcttgttggg cacgctgctg atcctgccgc tcaaagtggt gatgggtccg       180
     gtttgggcca tcacctcgct gggtgggttg atctcgccgg tgtcttttct gttcaactgg       240
     ctgattacgg tcatcttgtt tggtttggcc gcttggctga ttccgggctt tcgccttaag       300
     aacggtctga tcagtgccat tggtggcgcg gttatctaca gcgtgattag tgccgtggtc       360
     ttgcgtgctc ttggcctcgc tgatgtggac ttcaccaggg ccgccttgat cgggtcgttg       420
     gcctag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page