(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE75

CP000435.PE75        Location/Qualifiers
FT   CDS_pept        80858..81763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0076"
FT                   /product="Curli production assembly/transport component
FT                   CsgG subfamily protein"
FT                   /note="identified by match to protein family HMM PF03783"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46745"
FT                   /db_xref="GOA:Q0IE08"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE08"
FT                   /protein_id="ABI46745.1"
FT                   /translation="MTIDSIYFGKAVVYILRESWLIYLLILIVMKDRTAAIFPSFFIGL
FT                   AFVGSFASIAGPTVSVPDFKNEVGQLAWWSPRVSRQLADALSNELSAAGGLTVVERQNV
FT                   RAVLSEQEMAELGIVRNNDRAAKSGQMTGSQYVILGRVSGFENNVETKQSGSGMRFLGF
FT                   GGSKDVAETKAYVSLDLRVVDTTTGEVVGYKTVEGRAKNTAKVKGSGGSLAPLAGLVGG
FT                   LTGASGTGAYGLAAAGTLSFNESSSETKKTPASKAVRAALIAASDYVSCLLVRKDQCLD
FT                   DYARGDAQRRQNTLDVLEMD"
     atgaccattg actcaattta ctttggaaaa gctgttgttt acatactcag ggaatcgtgg        60
     ttaatttatt tgctgatact tattgttatg aaagatcgga cggctgcaat ctttccctcg       120
     ttttttattg gacttgcttt tgttggctca tttgcgtcga tcgcaggtcc aactgtatct       180
     gtaccagatt ttaaaaacga agttggccag ttggcatggt ggagtcccag ggtgagtagg       240
     caactggctg atgctctttc gaacgaattg tctgctgcag gtggactcac tgtggtcgaa       300
     aggcaaaatg ttagggctgt gttatccgag caggagatgg ccgaacttgg catcgttaga       360
     aataatgatc gtgctgcaaa gtctggacag atgactggtt ctcaatacgt cattcttggt       420
     cgagtaagcg gctttgaaaa taatgtggaa acaaagcagt ctggaagcgg aatgaggttt       480
     ctggggtttg gaggctccaa ggatgtggca gaaactaagg cgtatgtttc actagatctt       540
     cgtgttgttg atacaactac gggtgaagtt gttggctata aaactgttga aggcagggcg       600
     aaaaatacgg ccaaagtaaa gggatctggt ggctctttag ctcctctggc tggtttggtt       660
     ggtggattaa caggtgctag cggtactggt gcttatggtc tggcagcagc tggaacattg       720
     agtttcaatg agtcttcgag cgaaacgaaa aaaactccag cttccaaagc tgttcgtgcc       780
     gctctaatag ccgcatcaga ttatgtgtct tgcctcttgg ttcggaaaga tcaatgcctt       840
     gatgattatg caaggggtga tgctcaacgt cggcagaaca ctttggacgt attggagatg       900
     gattaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page