(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE8

CP000435.PE8         Location/Qualifiers
FT   CDS_pept        10474..11136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0008"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45564"
FT                   /db_xref="GOA:Q0IE75"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE75"
FT                   /protein_id="ABI45564.1"
FT                   /translation="MSASPSGSQALRLSFVLRWLGITLVVLLALQMAVLLSAADWADGV
FT                   FKQLLIERLVNQAPMGLIGLLLMLLGSRLDQPETARPPIRWLVCVISALLAILMIVVVP
FT                   VSISGNQNLSGESDQTLEQQKGQLEMARQQSANPENVKMLGNQLTQAGQLPADASEEDQ
FT                   VKAAQAFIDKQLAQMEQQIKQGERQRNLAVNQRRFGGTLSAVILAVAFVLLALAAVI"
     gtgtccgcat ccccttcggg ttctcaagcc ttacgacttt catttgttct gaggtggttg        60
     ggcatcaccc tggttgtgct gctggcattg cagatggctg tgcttttgag tgcagccgat       120
     tgggccgacg gagtctttaa gcaactgtta attgagcgct tggtcaatca agcccctatg       180
     gggctgatcg ggcttttgct catgcttttg ggctcgcgcc ttgaccaacc ggagacagca       240
     agacctccaa ttcgttggtt ggtttgcgtg atttctgcgc tgttggcgat tttgatgatc       300
     gttgttgttc ctgtttcgat ctcaggcaat cagaaccttt caggtgaatc ggatcaaacg       360
     cttgagcagc aaaagggtca gttggagatg gctcgtcagc aatcggctaa ccctgaaaac       420
     gtgaaaatgc tgggtaacca gctcactcag gcaggacagt tgcctgctga tgccagtgag       480
     gaagaccagg tcaaagctgc tcaggctttc atcgataagc agctggcgca gatggaacag       540
     cagatcaagc agggggaacg tcagcgcaac cttgctgtga atcagcgtcg cttcggaggg       600
     accttgagtg cggtgattct tgccgttgct ttcgtgctct tggctctggc ggccgtgatc       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page