(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE83

CP000435.PE83        Location/Qualifiers
FT   CDS_pept        88881..90002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0085"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47290"
FT                   /db_xref="GOA:Q0IE00"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE00"
FT                   /protein_id="ABI47290.1"
FT                   /translation="MMDSFVQLLREWPPGYGGVERVAHELASEWGATVFSFDAQSRSAD
FT                   EIDPLQVSYPRVVLPASPPFGRLLLPLPSRALWSLLRSHRPLYGHLPSPGVLLVLLLAR
FT                   LLQPRRPVFAHWHCFVAPEPGSKNRLFAVYQWLALRVVPHLTKVITTSPVLAKELIRCG
FT                   CQAARVAVLPCCLNAEQEKVLLALPSRSATGMPLRVLFIGRLDSYKRLDWLLEALSQLD
FT                   APWSLAVVGDGPRRLAFEALSAELFGVSSAVNFLGRLDETAKLAELASADVLVLPSDRS
FT                   TEAFGIVQLEAMAAGIPSLAFQNKRSGMGWVGQLSGLPWSQQPDQLSLVLNQLATSPAL
FT                   RTALSLEARDRYLYLFARKVWSEAFDSIFSSQK"
     gtgatggact cttttgttca actcctgcgc gaatggcctc caggctatgg aggagtggag        60
     cgggtggccc atgaattagc gagtgagtgg ggagcaacgg tgttcagctt tgatgcgcaa       120
     tcccgcagcg ctgatgagat tgatcctttg caggtttctt atccgcgagt ggtattgccg       180
     gccagtccac ctttcggccg gttgttgctt cctttgccat cacgtgcgct atggagcctg       240
     ttgcgctccc atcggcctct ctatgggcat ttgccatcgc caggggtgct gttggtgtta       300
     ctgctggccc gtcttttgca accgcgtcgg ccagtgttcg cgcattggca ctgctttgtt       360
     gccccggaac caggttcgaa gaatcgcctc tttgctgtct atcagtggtt ggcccttcgt       420
     gttgtcccac acctaaccaa agtcattacg acctctcccg tactggcgaa agagttgatt       480
     cgttgtggat gccaggccgc tcgtgtggct gttttgccct gttgtctgaa tgcagagcaa       540
     gaaaaggttc tattggcgtt gccatcgcgc tccgcaacag gaatgccatt gcgggtgtta       600
     ttcatcggcc ggcttgatag ttacaagcgc ttggactggt tgttggaagc tctttcccag       660
     ttagacgctc cttggtcttt ggcggtcgtc ggtgatggtc cacgcaggct tgcctttgaa       720
     gcgctcagtg ccgagttgtt tggcgtgagt tccgctgtga atttcttggg ccgtttggat       780
     gagacggcga agttggcaga actcgcctct gcagacgttt tggtgctccc ctcggatcgt       840
     tccacagaag ccttcgggat cgtgcagtta gaggcaatgg cggccgggat tccgtcactt       900
     gcttttcaaa acaagcgttc tgggatgggc tgggtcggac agctgtctgg attgccttgg       960
     tctcaacagc ctgatcagtt gtcgttggtt ctcaatcaat tggcgacttc gcccgcactt      1020
     cgaacagcgc tgagccttga ggcgcgcgac agatatctct atttatttgc tcgcaaggtt      1080
     tggtcggagg ctttcgattc gatcttctcc tcacaaaaat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page