(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE86

CP000435.PE86        Location/Qualifiers
FT   CDS_pept        complement(93784..94773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0088"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46669"
FT                   /db_xref="GOA:Q0IDZ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ7"
FT                   /protein_id="ABI46669.1"
FT                   /translation="MRFHIQQESDIPASTQLYNQICFAIAARHYPPGHRLPSTRQLAMQ
FT                   TGLHRNTISKVYRQLETDGVVEAMAGSGIYVRDQQKPREIRTPPHIRNRGVTDLDREVR
FT                   KCVDGLLNAGCTLQQTREMLTREIDWRLRCGARVLVSTPREDIGASMLIAEELEPNINV
FT                   PVEVVPMEELESVLENASNGTVVTSRYFLQPVEELAKKHGVRAVAVDLNDFKAELGMLK
FT                   ELRQGSCVGLVSISPGILRAAEVILHSMRGNDLLLMTATPDIGSRLLALLRASSHVLCD
FT                   RPSMPLVEQSLRQNRSQLMRMPQVHCAESYLSGDTIELLRKEIGLISH"
     gtgcgattcc acatccaaca ggaaagcgac ataccggcat cgacccagct ctacaaccag        60
     atctgtttcg ctattgccgc ccggcactac ccgccagggc atcgtcttcc gagtacgaga       120
     cagctcgcga tgcagaccgg cttgcatcgc aacaccatca gcaaggtgta ccgccaactg       180
     gaaaccgatg gcgtggtgga agcgatggca ggttccggga tctacgtgcg tgatcaacag       240
     aagccacggg agatccgaac ccctccccat atccgcaatc gtggcgtcac cgatctcgat       300
     cgagaggtgc gcaaatgcgt ggatggcctg ctcaacgcgg gttgcaccct gcagcaaacc       360
     agagaaatgc tcacgcgtga aatcgattgg cgcctgcgct gcggcgccag ggtgctcgtg       420
     agcacccctc gagaagacat tggcgcttcg atgctcatcg cagaggaact cgaacccaac       480
     atcaacgtgc ctgtggaagt ggtaccaatg gaagagttgg aaagcgtgct cgagaacgcc       540
     agcaatggca cggtggtgac gagcagatac ttcctgcagc ccgtagaaga gcttgccaag       600
     aagcacggtg tgcgcgctgt tgcggtggat ctcaacgact tcaaggctga attggggatg       660
     ctcaaagagc tccgccaagg cagctgcgtt ggccttgtga gcatcagccc cggcatcctg       720
     cgagccgccg aggtgatcct gcacagcatg cgcggcaatg acctgttgct gatgacggcg       780
     actccagaca tcggcagccg gctactagcc cttctgcgcg cctccagcca cgtgctctgt       840
     gatcgcccca gcatgccgtt ggtggaacaa agcctccgtc aaaaccgctc ccagctgatg       900
     cgcatgcccc aagtgcactg cgccgagagc tacctcagtg gtgacacgat cgaactactc       960
     cgcaaagaaa tcggcctgat cagccactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page