(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE94

CP000435.PE94        Location/Qualifiers
FT   CDS_pept        complement(100483..100962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0096"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46583"
FT                   /db_xref="GOA:Q0IDY9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY9"
FT                   /protein_id="ABI46583.1"
FT                   /translation="MAPNISNVSVNTPDGANKTLGSYSGKVLLIVNVASRCGFTRQYSG
FT                   LQALQDSYAAQGLQVLGFPCNDFGGQEPGSLEEIKSFCSTTYNASFELFDKVHATGSTT
FT                   EPYTTLNKTEPAGDVAWNFEKFLVGKDGTVIARFKSGVEPDSDELKTAIESALNA"
     atggctccca acatcagcaa cgtgtccgtc aacacccccg acggcgccaa caaaacactc        60
     ggttcttact ccggcaaggt gcttttaatc gtgaacgtgg ctagccgctg cggatttact       120
     cgccagtaca gcggtctgca agcgttgcaa gacagctacg ccgctcaagg gcttcaggtg       180
     ttgggattcc cctgcaacga ctttggcggt caagagcccg ggtctttaga ggagatcaaa       240
     agcttctgct ccaccactta caacgccagc tttgagctgt tcgacaaagt gcatgccact       300
     ggaagcacca ctgagcccta caccaccctc aacaaaacag agcctgcggg cgatgtggct       360
     tggaactttg agaagttcct cgtaggcaaa gacggcacgg tcatcgcaag atttaaaagc       420
     ggagttgagc ccgattcaga tgagctgaag actgcgattg aatccgccct taacgcctaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page