(data stored in SCRATCH3701 zone)

EMBL: CP000435.PETD

CP000435.PETD        Location/Qualifiers
FT   CDS_pept        527269..527751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="sync_0550"
FT                   /product="cytochrome b6-f complex, subunit IV"
FT                   /note="identified by match to protein family HMM PF00032;
FT                   match to protein family HMM TIGR01156"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47740"
FT                   /db_xref="GOA:Q0ICP7"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICP7"
FT                   /protein_id="ABI47740.1"
FT                   /translation="MHILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACIVGLSVLDPAMLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLV
FT                   PLGLMLIPFIESFNKFQNPFRRPIAMAVFLFGTATTIYLGIGAAMPIDKSLTLGLF"
     atgcatattc tcaagaagcc tgatctcacc gaccccaagt tgcgggccaa gctcgccaaa        60
     ggcatgggtc ataactatta cggtgagccg gcatggccca atgatcttct ctacatcttc       120
     cctgtagtca ttcttggcac cattgcctgc attgtcggtc tgtccgtctt agatccagcc       180
     atgctgggcg acaaagccga tccgttcgca acaccgcttg aaatcctccc tgagtggtac       240
     ctctatccgg tgttccagat cctcagggtt gttcctaaca agcttcttgg tatcgcactg       300
     caaaccttgg ttccccttgg tttgatgctt attccattca ttgagagctt taacaagttt       360
     cagaacccat tccgccgtcc tatcgcgatg gcagtcttct tgttcggtac agctaccact       420
     atctatttgg gaatcggtgc tgcgatgcct atcgacaagt cactgactct cggtttgttc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page